Bṛhat Parāśara Horā Śāstra बृहत्पाराशर होराशास्त्र

संस्कृत

अथ सृष्टिक्रमवर्णनाध्यायः ॥ १ ॥ अथैकदा सुखासीनं पार्श्वे हिमवतः शुभे । महर्षिप्रवरं पूज्यं पराशरमुदारधीः ॥ १ ॥

atha srishtikramavarnanaadhyaayah || 1 || athaikadaa sukhaasiinam paarshve himavatah shubhe | maharshipravaram puujyam paraasharamudaaradhiih || 1 ||

अंग्रेज़ी अर्थ

Chapter One: The Description of the Order of Creation. Once, comfortably seated at an auspicious spot beside the Himālayas, [was] the venerable and foremost of great sages, Parāśara, of noble intellect.

हिन्दी अर्थ

अध्याय १: सृष्टिक्रम-वर्णन। एक बार हिमालय के समीप एक शुभ स्थान में, सुखपूर्वक विराजमान, उदार बुद्धि वाले, पूज्य एवं महर्षियों में श्रेष्ठ पराशर जी विराजमान थे।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image at 400dpi; the chapter-title line and verse 1 are transcribed exactly as printed. English/Hindi meanings by Vedic Hora -- for review (the edition's own Hindi prose commentary is NOT reproduced, per copyright policy).

संस्कृत

मैत्रेयो हि मुनिर्होराशास्त्रजिज्ञासया स्वयम् । साष्टाङ्गप्रणिपातेन प्रणम्येदमुवाच ह ॥ २ ॥

maitreyo hi munirhoraashaastrajijnaasayaa svayam | saashtaangapranipaatena pranamyedamuvaacha ha || 2 ||

अंग्रेज़ी अर्थ

The sage Maitreya, himself moved by a desire to know the science of Horā, having bowed down to him with a full eight-limbed prostration, thus spoke.

हिन्दी अर्थ

मैत्रेय मुनि ने स्वयं होराशास्त्र जानने की इच्छा से उन्हें साष्टांग प्रणाम करके यह कहा।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मैत्रेय उवाच— भगवन् ! भवता लोककल्याणाय कलौ युगे । यथोदिता स्मृतिस्तद्वत् कृपयाऽनन्ताय मे ॥ ३ ॥

maitreya uvaacha-- bhagavan ! bhavataa lokakalyaanaaya kalau yuge | yathoditaa smritistadvat kripayaa'nantaaya me || 3 ||

अंग्रेज़ी अर्थ

Maitreya said: O Lord! Just as, for the welfare of the world in the Kali age, you have already declared the sacred tradition (smṛti), likewise, out of [your] compassion, [declare it] for me. [DISCLOSED: the word "anantāya" (dative, lit. "to the limitless one") does not straightforwardly agree grammatically with the surrounding words in this line as printed; it is rendered here as intensifying the compassion invoked ("boundless compassion") rather than forcing a different construction.]

हिन्दी अर्थ

मैत्रेय ने कहा: हे भगवन्! जिस प्रकार आपने कलियुग में लोक-कल्याण के लिए स्मृति का प्रवचन किया है, उसी प्रकार अपनी कृपा से मुझे भी बताइए। [स्पष्टीकरण: मूल पंक्ति में "अनन्ताय" शब्द का ठीक अन्वय अनिश्चित है; यहाँ इसे "असीम कृपा" के भाव में लिया गया है।]

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image at 400dpi; grammatical ambiguity of "anantaaya" disclosed above. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

होराशास्त्रं प्रसिद्धं यत् त्रिस्कन्धज्योतिषोद्धृतम् । तदेव दैवज्ञमुदे विस्तरादुच्यतामिह ॥ ४ ॥

horaashaastram prasiddham yat triskandhajyotishoddhritam | tadeva daivajnamude vistaraaduchyataamiha || 4 ||

अंग्रेज़ी अर्थ

That well-known Horāśāstra, which has been drawn out from the three-branched science of Jyotiṣa -- may that very same [science] be expounded here at length, for the delight of astrologers (daivajña).

हिन्दी अर्थ

जो प्रसिद्ध होराशास्त्र त्रिस्कन्ध ज्योतिष से उद्धृत हुआ है, वही ज्योतिषियों के हर्ष के लिए यहाँ विस्तारपूर्वक कहा जाए।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कथमस्य हि विश्वस्य प्रभवोऽथ लयो भवेत् । नभःस्थायिग्रहाणाश्च भूमिष्ठप्राणिनां मिथः ॥ ५ ॥

kathamasya hi vishvasya prabhavo'tha layo bhavet | nabhahsthaayigrahaanaashcha bhuumishthapraaninaam mithah || 5 ||

अंग्रेज़ी अर्थ

How indeed does the origination, and then the dissolution, of this universe occur? And what is the mutual [relationship] between the planets residing in the sky and the beings established on the earth?

हिन्दी अर्थ

इस विश्व की उत्पत्ति और प्रलय कैसे होते हैं? और आकाश में स्थित ग्रहों का तथा पृथ्वी पर रहने वाले प्राणियों का आपस में कैसा सम्बन्ध है?

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कीदृशोऽस्ति च सम्बन्धः फलं येन प्रजायते । एतत्सर्वं समाख्याहि त्वं दैवज्ञेषु विश्रुतः ॥ ६ ॥

kiidrisho'sti cha sambandhah phalam yena prajaayate | etatsarvam samaakhyaahi tvam daivajneshu vishrutah || 6 ||

अंग्रेज़ी अर्थ

And of what nature is that bond, by which result (phala) is produced? Declare all this, you who are renowned among astrologers.

हिन्दी अर्थ

वह सम्बन्ध कैसा है, जिससे फल उत्पन्न होता है? हे ज्योतिषियों में विख्यात! यह सब मुझे बताइए।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पराशर उवाच— मुनेऽधुनैव ते प्रश्नः कृतो लोकहितेच्छया । अतोऽहं परमं ब्रह्मन् ! शक्तिमत्परमेश्वरम् ॥ ७ ॥

paraashara uvaacha-- mune'dhunaiva te prashnah krito lokahitechchhayaa | ato'ham paramam brahman ! shaktimatparameshvaram || 7 ||

अंग्रेज़ी अर्थ

Parāśara said: O sage, this question of yours has just now been asked out of a desire for the welfare of the world. Therefore, O Brahmin, [having bowed to] the supreme, mighty Parameśvara --

हिन्दी अर्थ

पराशर ने कहा: हे मुनि! आपका यह प्रश्न लोक-हित की इच्छा से ही अभी किया गया है। इसलिए हे ब्राह्मण! परम शक्तिशाली परमेश्वर को...

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image at 400dpi; sentence continues into verse 1.8. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वयं नत्वा ग्रहपतिं जगदुत्पत्तिकारणम् । वक्ष्यामि वेदनयनं यथा ब्रह्ममुखाच्छ्रुतम् ॥ ८ ॥

svayam natvaa grahapatim jagadutpattikaaranam | vakshyaami vedanayanam yathaa brahmamukhaachchhrutam || 8 ||

अंग्रेज़ी अर्थ

-- myself having bowed to the Lord of the Planets [the Sun], the cause of the world's origination, I shall declare the Eye of the Veda [i.e. the science of Jyotiṣa], exactly as it was heard from the mouth of Brahmā. [DISCLOSED: the closing compound's middle syllables ("...mukhaach-chhrutam") sit at the zoom-resolution ceiling; the reading adopted, "brahmamukhaachchhrutam" ("as heard from Brahma's mouth"), is a well-attested formula in this genre and is grammatically and contextually sound, but the exact conjunct was not independently zoom-verified beyond 700dpi.]

हिन्दी अर्थ

...ग्रहपति (सूर्य) को, जो जगत की उत्पत्ति के कारण हैं, स्वयं नमन करके, मैं वेद के नेत्र-स्वरूप ज्योतिषशास्त्र को वैसे ही कहूँगा जैसे ब्रह्माजी के मुख से सुना गया था।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.34 (main-text printed page 1). Sanskrit root verse read directly from page-image, cross-checked at 700dpi crop; closing-compound ambiguity disclosed above. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शान्ताय गुरुभक्ताय सदा सत्पथगामिने । आस्तिकाय प्रदातव्यं ततः श्रेयो ह्यवाप्स्यति ॥ ९ ॥

shaantaaya gurubhaktaaya sadaa satpathagaamine | aastikaaya pradaatavyam tatah shreyo hyavaapsyati || 9 ||

अंग्रेज़ी अर्थ

It should be given to one who is peaceful, devoted to his guru, ever walking the righteous path, and a believer (āstika) -- thereby [that recipient] shall attain the highest good.

हिन्दी अर्थ

यह ज्योतिषशास्त्र शान्त, गुरुभक्त, सदा सन्मार्ग पर चलने वाले और आस्तिक व्यक्ति को ही देना चाहिए, जिससे उसका कल्याण हो।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.35 (main-text printed page 4). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review (the edition's own Hindi prose commentary is NOT reproduced, per copyright policy).

संस्कृत

न देयं परशिष्याय नास्तिकाय शठाय च । दत्ते प्रतिदिनं दुःखं जायते नात्र संशयः ॥ १० ॥

na deyam parashishyaaya naastikaaya shathaaya cha | datte pratidinam duhkham jaayate naatra samshayah || 10 ||

अंग्रेज़ी अर्थ

It should not be given to another's disciple, nor to a non-believer (nāstika), nor to a deceitful person. If given [to such a one], sorrow arises daily -- in this there is no doubt.

हिन्दी अर्थ

इसे दूसरे के शिष्य को, नास्तिक को और धूर्त व्यक्ति को नहीं देना चाहिए। ऐसे व्यक्ति को देने पर प्रतिदिन दुःख उत्पन्न होता है, इसमें कोई सन्देह नहीं है।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.35 (main-text printed page 4). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एकोऽव्यक्तात्मको विष्णुरनादिः प्रभुरीश्वरः । शुद्धतत्त्वो जगत्स्वामी निर्गुणस्त्रिगुणान्वितः ॥ ११ ॥

eko'vyaktaatmako vishnuranaadih prabhuriishvarah | shuddhatattvo jagatsvaamii nirgunastrigunaanvitah || 11 ||

अंग्रेज़ी अर्थ

Viṣṇu is one, of unmanifest nature, without beginning, the Lord, the Master; of pure essence, the Lord of the universe -- [though himself] without qualities (nirguṇa), [yet] possessed of the three guṇas.

हिन्दी अर्थ

विष्णु एक, अव्यक्त स्वरूप, अनादि, प्रभु और ईश्वर हैं; शुद्ध तत्त्व वाले, जगत के स्वामी, निर्गुण होते हुए भी तीनों गुणों से युक्त हैं।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.35 (main-text printed page 4). Sanskrit root verse read directly from page-image at 400dpi; a Hindi editorial subheading ("sṛṣṭikrama kā varṇana") appears immediately before this verse in the source and is not reproduced, per copyright policy. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

संसारकारकः श्रीमान् निमित्तात्मा प्रतापवान् । एकांशेन जगत्सर्वं सृजत्यवति लीलया ॥ १२ ॥

samsaarakaarakah shriimaan nimittaatmaa prataapavaan | ekaamshena jagatsarvam srijatyavati liilayaa || 12 ||

अंग्रेज़ी अर्थ

The cause of the phenomenal world, glorious, the instrumental cause [of creation], mighty -- with a single portion (aṃśa) of himself he creates and sustains the entire universe, as if in sport (līlā).

हिन्दी अर्थ

संसार के कारण, श्रीमान्, निमित्त-स्वरूप, प्रतापवान् विष्णु अपने एक अंश से ही सम्पूर्ण जगत की सृष्टि और पालन लीलापूर्वक करते हैं।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.35 (main-text printed page 4). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रिपादं तस्य देवस्य ह्यमृतं तत्त्वदर्शिनः । विदन्ति तत्प्रमाणं च सप्रधानं तथैकपात् ॥ १३ ॥

tripaadam tasya devasya hyamritam tattvadarshinah | vidanti tatpramaanam cha sapradhaanam tathaikapaat || 13 ||

अंग्रेज़ी अर्थ

Three quarters of that god are imperishable [known only] to the seers of truth (tattva-darśin); they know its measure, together with [its remaining] one quarter accompanied by pradhāna (primordial matter). [This verse echoes the classical Puruṣa-sūkta doctrine that three-quarters of the cosmic Person are immortal/unmanifest and one quarter is the manifest world.]

हिन्दी अर्थ

उस देव के तीन चरण अमृत-स्वरूप हैं, जिन्हें केवल तत्त्वदर्शी ही जानते हैं; वे उसका प्रमाण और प्रधान (प्रकृति) सहित उसके एक चरण को भी जानते हैं। [यह श्लोक पुरुषसूक्त के उस सिद्धान्त की प्रतिध्वनि है, जिसमें पुरुष के तीन चरण अमृत और एक चरण यह प्रकट संसार बताया गया है।]

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.35 (main-text printed page 4). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

व्यक्ताऽव्यक्तात्मको विष्णुर्वासुदेवस्तु गीयते । यदव्यक्तात्मको विष्णुः शक्तिद्वयसमन्वितः ॥ १४ ॥

vyaktaa'vyaktaatmako vishnurvaasudevastu giiyate | yadavyaktaatmako vishnuh shaktidvayasamanvitah || 14 ||

अंग्रेज़ी अर्थ

Viṣṇu, of both manifest and unmanifest nature, is indeed extolled as Vāsudeva; and when unmanifest in nature, Viṣṇu is endowed with a pair of powers (śakti-dvaya).

हिन्दी अर्थ

व्यक्त और अव्यक्त दोनों स्वरूपों वाले विष्णु ही वासुदेव कहलाते हैं; अव्यक्त स्वरूप में विष्णु दो शक्तियों से युक्त होते हैं।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.35 (main-text printed page 4). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रिशक्तियुक्तो व्यक्तात्मा गदितोऽनन्तशक्तिभृत् । सत्त्वप्रधाना श्रीशक्तिर्भूशक्तिश्च रजोगुणा ॥ १५ ॥

trishaktiyukto vyaktaatmaa gadito'nantashaktibhrit | sattvapradhaanaa shriishaktirbhuushaktishcha rajogunaa || 15 ||

अंग्रेज़ी अर्थ

The manifest self, endowed with three powers, is declared to be the bearer of infinite power. Of these, Śrī-śakti is predominantly sattvic, and Bhū-śakti is of the rajas quality.

हिन्दी अर्थ

व्यक्त आत्मा, तीन शक्तियों से युक्त, अनन्त शक्ति का धारक कहा गया है। इनमें श्रीशक्ति सत्त्वप्रधान है और भूशक्ति रजोगुण वाली है।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.35 (main-text printed page 4). Sanskrit root verse read directly from page-image, second line cross-verified at 700dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शक्तिस्तृतीया या प्रोक्ता नीलाख्या तमोरूपिणी । वासुदेवश्चतुर्थोऽभूच्छ्रीशक्त्या प्रेरितो यदा ॥ १६ ॥

shaktistritiiyaa yaa proktaa niilaakhyaa tamoruupinii | vaasudevashchaturtho'bhuuchchhriishaktyaa prerito yadaa || 16 ||

अंग्रेज़ी अर्थ

The third power, which is proclaimed, is called Nīlā, of the nature of tamas [darkness]. Vāsudeva became the fourth [form] when impelled by Śrī-śakti. [DISCLOSED: the first line's middle two syllables (rendered here as "tamo-") sit directly under this scan's baked-in digitizer watermark and were not independently pixel-legible even at 1200dpi; "tamo-rūpiṇī" is an inferred reconstruction, cross-checked against the 8-syllable anuṣṭubh meter (which it fits exactly) and against the immediately following Hindi editorial commentary's paraphrase of this power as "andhakāra-svarūpā" ("of the nature of darkness") -- it is presented as an inference, not a direct reading, and a cleaner scan should be sought to confirm it.]

हिन्दी अर्थ

जो तीसरी शक्ति कही गई है, वह नीला नाम की, तमःस्वरूपा है। जब श्रीशक्ति से प्रेरित होकर वासुदेव चौथे रूप में प्रकट हुए। [स्पष्टीकरण: पहली पंक्ति के मध्य के दो अक्षर स्कैन के वॉटरमार्क से ढके होने के कारण सीधे नहीं पढ़े जा सके; "तमो-" पाठ अनुमानित है, छन्द और सन्दर्भ से समर्थित किन्तु प्रत्यक्ष-पठित नहीं।]

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF pp.35-36 (main-text printed pages 4-5) -- line 1 on p.35 (obscured by watermark, see disclosure above), line 2 on p.36. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सङ्कर्षणश्च प्रद्युम्नोऽनिरुद्ध इति मूर्तिधृक् । तमःशक्त्यान्वितो विष्णुर्देवः सङ्कर्षणाभिधः ॥ १७ ॥

sankarshanashcha pradyumno'niruddha iti muurtidhrik | tamahshaktyaanvito vishnurdevah sankarshanaabhidhah || 17 ||

अंग्रेज़ी अर्थ

[Vāsudeva] assumed the forms named Saṅkarṣaṇa, Pradyumna, and Aniruddha. Of these, the god Viṣṇu endowed with the power of tamas is named Saṅkarṣaṇa.

हिन्दी अर्थ

संकर्षण, प्रद्युम्न और अनिरुद्ध — इस प्रकार [वासुदेव ने] तीन रूप धारण किए। इनमें तमःशक्ति से युक्त विष्णुदेव संकर्षण कहलाते हैं।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.36 (main-text printed page 5). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्रद्युम्नो रजसा शक्त्याऽनिरुद्धः सत्त्वया युतः । महान् सङ्कर्षणाज्जातः प्रद्युम्नाद् यदहङ्कृतिः ॥ १८ ॥

pradyumno rajasaa shaktyaa'niruddhah sattvayaa yutah | mahaan sankarshanaajjaatah pradyumnaad yadahankritih || 18 ||

अंग्रेज़ी अर्थ

Pradyumna is endowed with the power of rajas, [and] Aniruddha is endowed with sattva. Mahat (the Great Principle) arose from Saṅkarṣaṇa, and ahaṅkāra (ego-principle) from Pradyumna.

हिन्दी अर्थ

प्रद्युम्न रजःशक्ति से और अनिरुद्ध सत्त्वशक्ति से युक्त हैं। संकर्षण से महत्तत्त्व की और प्रद्युम्न से अहंकार की उत्पत्ति हुई।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.36 (main-text printed page 5). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अनिरुद्धात् स्वयं जातो ब्रह्माऽहङ्कारमूर्तिधृक् । सर्वेषु सर्वशक्तिश्च स्वशक्त्याधिकया युतः ॥ १९ ॥

aniruddhaat svayam jaato brahmaa'hankaaramuurtidhrik | sarveshu sarvashaktishcha svashaktyaadhikayaa yutah || 19 ||

अंग्रेज़ी अर्थ

From Aniruddha, Brahmā himself was born, bearing the form of ahaṅkāra. In all of these [three forms] every power exists, but each is endowed with an excess of its own [particular] power.

हिन्दी अर्थ

अनिरुद्ध से स्वयं ब्रह्मा उत्पन्न हुए, जो अहंकार-स्वरूप हैं। इन सभी में सभी शक्तियाँ विद्यमान हैं, परन्तु प्रत्येक में अपनी-अपनी शक्ति अधिक मात्रा में होती है।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.36 (main-text printed page 5). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अहङ्कारस्त्रिधा भूत्वा सर्वमेतदविस्तरात् । सात्त्विको राजसश्चैव तामसश्चेदहङ्कृतिः ॥ २० ॥

ahankaarastridhaa bhuutvaa sarvametadavistaraat | saattviko raajasashchaiva taamasashchedahankritih || 20 ||

अंग्रेज़ी अर्थ

Ahaṅkāra (the ego-principle), having become threefold -- all this [is explained] briefly: sāttvika, rājasa, and tāmasa -- such is ahaṅkāra.

हिन्दी अर्थ

अहंकार तीन प्रकार का होकर — यह सब संक्षेप में — सात्त्विक, राजस और तामस, इस प्रकार अहंकार है।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.36 (main-text printed page 5). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

देवा वैकारिकाज्जातास्तैजसादिन्द्रियाणि च । तामसाश्चैव भूतानि खादीनि स्वस्वशक्तिभिः ॥ २१ ॥

devaa vaikaarikaajjaataastaijasaadindriyaani cha | taamasaashchaiva bhuutaani khaadiini svasvashaktibhih || 21 ||

अंग्रेज़ी अर्थ

The gods were born from the sāttvika (vaikārika) [ahaṅkāra], and the senses (indriyas) from the rājasa (taijasa) [ahaṅkāra]; and the elements (bhūtas), beginning with ether, from the tāmasa [ahaṅkāra] -- each by its own respective power.

हिन्दी अर्थ

सात्त्विक (वैकारिक) अहंकार से देवताओं की और राजस (तैजस) अहंकार से इन्द्रियों की उत्पत्ति हुई; तथा तामस अहंकार से आकाश आदि पंचमहाभूतों की उत्पत्ति हुई — सभी अपनी-अपनी शक्ति के अनुसार।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.36 (main-text printed page 5). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

श्रीशक्त्या सहितो विष्णुः सदा पाति जगत्त्रयम् । भूशक्त्या सृजते स्रष्टा नीलशक्त्या हरोऽत्ति हि ॥ २२ ॥

shriishaktyaa sahito vishnuh sadaa paati jagattrayam | bhuushaktyaa srijate srashtaa niilashaktyaa haro'tti hi || 22 ||

अंग्रेज़ी अर्थ

Viṣṇu, accompanied by Śrī-śakti, ever protects/sustains the three worlds; the Creator [Brahmā] creates by means of Bhū-śakti; and Hara [Śiva/Rudra] indeed devours/dissolves [the universe] by means of Nīla-śakti.

हिन्दी अर्थ

श्रीशक्ति से युक्त विष्णु सदा तीनों लोकों का पालन करते हैं; भूशक्ति से स्रष्टा (ब्रह्मा) सृष्टि करते हैं, और नीलशक्ति से हर (शिव) उसका संहार करते हैं।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.36 (main-text printed page 5). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सर्वेषु चैव जीवेषु परमात्मा विराजते । एवं हि तदिदं ब्रह्मन् ! स्थितं हि परमात्मनि ॥ २३ ॥

sarveshu chaiva jiiveshu paramaatmaa viraajate | evam hi tadidam brahman ! sthitam hi paramaatmani || 23 ||

अंग्रेज़ी अर्थ

In all living beings indeed, the Supreme Soul (Paramātmā) resides. Thus indeed, O Brahmin, all this [universe] is situated within the Paramātmā.

हिन्दी अर्थ

सभी जीवों में परमात्मा विराजमान हैं। हे ब्राह्मण! इसी प्रकार यह सम्पूर्ण संसार परमात्मा में ही स्थित है।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.37 (main-text printed page 6). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review (the edition's own extensive Hindi commentary and Sāṅkhya-philosophy discussion following these verses is NOT reproduced, per copyright policy).

संस्कृत

सर्वेषु चैव जीवेषु स्थितं ह्यंशद्वयं क्वचित् । जीवांशकोऽधिकस्तद्वत् परमात्मांशकः क्वचित् ॥ २४ ॥

sarveshu chaiva jiiveshu sthitam hyamshadvayam kvachit | jiivaamshako'dhikastadvat paramaatmaamshakah kvachit || 24 ||

अंग्रेज़ी अर्थ

In all living beings, a pair of portions [the jīva's own portion and the Paramātmā's portion] indeed resides in some measure. In some [beings] the jīva-portion is greater; likewise, in others, the Paramātmā-portion [is greater].

हिन्दी अर्थ

सभी जीवों में दोनों अंश — जीवांश और परमात्मांश — किसी न किसी मात्रा में विद्यमान रहते हैं। कहीं जीवांश अधिक होता है, तो कहीं परमात्मांश अधिक होता है।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.37 (main-text printed page 6). Sanskrit root verse read directly from page-image, cross-verified at 800dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सूर्यादयो ग्रहाः सर्वे ब्रह्मकामःद्विपादयः । एते चान्ये च बहवः परमात्मांशकाधिकाः ॥ २५ ॥

suuryaadayo grahaah sarve brahmakaamahdvipaadayah | ete chaanye cha bahavah paramaatmaamshakaadhikaah || 25 ||

अंग्रेज़ी अर्थ

The Sun and other planets, all of them, together with [DISCLOSED, uncertain compound below] -- these and many other [beings/deities] have a greater portion of the Paramātmā. [DISCLOSED: the first line's second compound (transcribed here letter-for-letter as printed, "brahmakaamah-dvipaadayah") did not yield a fully confident grammatical parse even after a dedicated 1400dpi zoom -- the visible glyphs read "ब्रह्मकामः द्विपादयः", but this does not straightforwardly mean "Brahma, Shiva and other bipeds" (the sense the surrounding Hindi editorial commentary implies for this line, naming Brahmā, Śiva and other deities as bipeds of greater Paramātmā-portion); the compound is transcribed exactly as printed rather than silently emended, and should be cross-checked against a second scan/edition in a future session.]

हिन्दी अर्थ

सूर्य आदि सभी ग्रह, तथा [स्पष्टीकरण: यह संयुक्त पद अनिश्चित है, नीचे देखें] — ये तथा अन्य अनेक [देवता] परमात्मांश की अधिकता वाले हैं। [स्पष्टीकरण: पहली पंक्ति के दूसरे शब्द-समूह ("ब्रह्मकामः द्विपादयः", अक्षरशः पढ़ा गया) का ठीक व्याकरणिक अन्वय 1400dpi ज़ूम के बाद भी निश्चित नहीं हो सका; भविष्य में किसी अन्य संस्करण से इसकी पुष्टि आवश्यक है।]

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.37 (main-text printed page 6). Sanskrit root verse read directly from page-image; first line's compound genuinely ambiguous even after zoom, disclosed above rather than emended. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शक्तयश्च तथैतेषामधिकांशाः श्रियाद्यः । सशक्तयः सुराश्चान्ये ज्ञेया जीवांशकाधिकाः ॥ २६ ॥

shaktayashcha tathaitesaamadhikaamshaah shriyaadyah | sashaktayah suraashchaanye jneyaa jiivaamshakaadhikaah || 26 ||

अंग्रेज़ी अर्थ

And likewise, their powers (śaktis), beginning with Śrī, are also of greater [Paramātmā-]portion. Other gods, together with [their] powers, should be known as having a greater portion of jīva [individual soul].

हिन्दी अर्थ

इसी प्रकार इनकी श्री आदि शक्तियों में भी परमात्मांश की अधिकता होती है। अन्य देवगण अपनी शक्तियों सहित जीवांश की अधिकता वाले जानने चाहिए।

स्रोत: BPHS Ch.1, Kashi Sanskrit Series No.220, PDF p.37 (main-text printed page 6). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review. This closes the currently-transcribed portion of Ch.1; the source continues with an extended Hindi editorial discussion of Sāṅkhya philosophy (prakṛti/puruṣa, the 25 tattvas) before the root verses resume -- that discussion is the editor's own prose and is not reproduced, per copyright policy.

संस्कृत

अथ अवतारक्रमवर्णनाध्यायः ॥ २ ॥ मैत्रेय उवाच— रामकृष्णादयो ये ये अवतारा रमापतेः । तेऽपि जीवांशसंयुक्ताः किंवा ब्रूहि मुनीश्वर ! ॥ १ ॥

atha avataarakramavarnanaadhyaayah || 2 || maitreya uvaacha-- raamakrishnaadayo ye ye avataaraa ramaapateh | te'pi jiivaamshasamyuktaah kimvaa bruuhi muniishvara ! || 1 ||

अंग्रेज़ी अर्थ

Now, the chapter describing the order of the avatars. Maitreya said: Whichever avatars there are of Ramāpati [Viṣṇu, the husband of Ramā/Lakṣmī] -- Rāma, Kṛṣṇa, and so on -- are they too joined with a jīva-portion, or [are they not]? Tell me, O lord of sages!

हिन्दी अर्थ

अब अवतारक्रमवर्णनाध्याय आरम्भ होता है। मैत्रेय ने कहा — हे मुनीश्वर! रमापति [विष्णु] के जो-जो अवतार हैं — राम, कृष्ण आदि — क्या वे भी जीवांश से युक्त हैं, या नहीं? यह मुझे बताइए।

स्रोत: BPHS Ch.2 opening + verse 1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.38 (main-text printed page 7). Sanskrit root verse read directly from page-image at 400dpi. This page also carries Ch.1's closing colophon ("iti savimarshasudhaavyaakhyopete brihatpaaraasharahoraashaastre srishtikramavarnanaadhyaayah samaaptah || 1 ||" -- "Thus ends the chapter on the order of creation... || 1 ||"), confirming Chapter 1 is complete at 26 verses. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पराशर उवाच— रामः कृष्णश्च भो विप्र ! नृसिंहः शूकरस्तथा । एते पूर्णावताराश्च ह्यन्ये जीवांशकान्विताः ॥ २ ॥

paraashara uvaacha-- raamah krishnashcha bho vipra ! nrisimhah shuukarastathaa | ete puurnaavataaraashcha hyanye jiivaamshakaanvitaah || 2 ||

अंग्रेज़ी अर्थ

Parāśara said: O Brahmin! Rāma, Kṛṣṇa, Nṛsiṃha, and likewise Śūkara [the Boar] -- these indeed are full/complete avatars (pūrṇāvatāra); other [avatars], however, are endowed with a jīva-portion.

हिन्दी अर्थ

पराशर ने कहा — हे विप्र! राम, कृष्ण, नृसिंह तथा शूकर [वराह] — ये चारों पूर्णावतार हैं; अन्य अवतार जीवांश से युक्त हैं।

स्रोत: BPHS Ch.2, verse 2, Kashi Sanskrit Series No.220, PDF p.38 (main-text printed page 7), cross-verified at 900dpi crop. English/Hindi meanings by Vedic Hora -- for review (the edition's own Hindi prose commentary naming these same four avatars is not reproduced, per copyright policy).

संस्कृत

अवताराण्यनेकानि ह्यजस्य परमात्मनः । जीवानां कर्मफलदो ग्रहरूपी जनार्दनः ॥ ३ ॥

avataaraanyanekaani hyajasya paramaatmanah | jiivaanaam karmaphalado graharuupii janaardanah || 3 ||

अंग्रेज़ी अर्थ

Many indeed are the avatars of the unborn Paramātmā. Janārdana [Viṣṇu], in the form of the planets (grahas), is the giver of the fruits of karma to living beings (jīvas).

हिन्दी अर्थ

अजन्मा परमात्मा के अनेक अवतार हैं। ग्रहरूपी जनार्दन [विष्णु] ही जीवों को उनके कर्मों का फल देने वाले हैं।

स्रोत: BPHS Ch.2, verse 3, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.39 (main-text printed page 8). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दैत्यानां बलनाशाय देवानां बलवृद्धये । धर्मसंस्थापनार्थाय ग्रहाज्ज्ञाताः शुभाः क्रमात् ॥ ४ ॥

daityaanaam balanaashaaya devaanaam balavriddhaye | dharmasamsthaapanaarthaaya grahaajjnaataah shubhaah kramaat || 4 ||

अंग्रेज़ी अर्थ

For the destruction of the strength of the daityas [demons], for the increase of the strength of the devas [gods], and for the establishment of dharma -- the planets, auspicious, are to be known [as avatars] in due order.

हिन्दी अर्थ

दैत्यों के बल का नाश करने, देवताओं के बल की वृद्धि करने और धर्म की स्थापना के लिए, ये शुभ ग्रह क्रमशः अवतार रूप में जाने जाते हैं।

स्रोत: BPHS Ch.2, verse 4, Kashi Sanskrit Series No.220, PDF p.39 (main-text printed page 8). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तद्यथा— रामोऽवतारः सूर्यस्य चन्द्रस्य यदुनायकः । नृसिंहो भूमिपुत्रस्य बुद्धः सोमसुतस्य च ॥ ५ ॥

tadyathaa-- raamo'vataarah suuryasya chandrasya yadunaayakah | nrisimho bhuumiputrasya buddhah somasutasya cha || 5 ||

अंग्रेज़ी अर्थ

As follows: Rāma is the avatar of the Sun (Sūrya); Yadunāyaka [Kṛṣṇa, leader of the Yadus] is of the Moon (Candra). Nṛsiṃha is of Bhūmiputra [Mars, "son of the Earth"]; and Buddha is of Somasuta [Mercury, "son of the Moon"].

हिन्दी अर्थ

जैसे — राम सूर्य के अवतार हैं, चन्द्रमा के यदुनायक [कृष्ण]। नृसिंह भूमिपुत्र [मंगल] के, तथा बुद्ध सोमसुत [बुध] के अवतार हैं।

स्रोत: BPHS Ch.2, verse 5, Kashi Sanskrit Series No.220, PDF p.39 (main-text printed page 8). Sanskrit root verse read directly from page-image at 400dpi. Begins the classical nine-graha/nine-avatara correspondence list. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वामनो विबुधेज्यस्य भार्गवो भार्गवस्य च । कूर्मो भास्करपुत्रस्य सैंहिकेयस्य शूकरः ॥ ६ ॥

vaamano vibudhejyasya bhaargavo bhaargavasya cha | kuurmo bhaaskaraputrasya sainhikeyasya shuukarah || 6 ||

अंग्रेज़ी अर्थ

Vāmana is of Vibudhejya [Jupiter, "preceptor of the gods"]; and Bhārgava [Paraśurāma] is of Bhārgava [Venus, "descendant of Bhṛgu"]. Kūrma is of Bhāskaraputra [Saturn, "son of the Sun"]; and Śūkara [Boar, Varāha] is of Saihikeya [Rāhu, "son of Siṃhikā"].

हिन्दी अर्थ

वामन विबुधेज्य [गुरु/बृहस्पति] के, और भार्गव [परशुराम] भार्गव [शुक्र] के अवतार हैं। कूर्म भास्करपुत्र [शनि] के, तथा शूकर [वराह] सैंहिकेय [राहु] के अवतार हैं।

स्रोत: BPHS Ch.2, verse 6, Kashi Sanskrit Series No.220, PDF p.39 (main-text printed page 8), cross-verified at 900dpi crop. This edition's font renders the syllable "shuu" (शू, in "Shuukara"/Boar) visually close to "suu" (सू) in several places on this page; cross-verified at 900dpi against the same word's clear rendering elsewhere in Ch.1-2, and standardized here to शूकर: (Shuukarah, "Boar"), consistent with the classical nine-graha-avatara list. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

केतोर्मीनावतारश्च ये चान्ये तेऽपि खेटजाः । परात्मांशोऽधिको येषु ते सर्वे खेचराभिधाः ॥ ७ ॥

ketormiinaavataarashcha ye chaanye te'pi khetajaah | paraatmaamsho'dhiko yeshu te sarve khecharaabhidhaah || 7 ||

अंग्रेज़ी अर्थ

And Mīna [the Fish] is the avatar of Ketu. Whichever other [avatars] there are, they too are graha-born (khetaja). Those in whom the portion of the Supreme Self (Paramātmā) is greater -- all of them are termed "khecara" [sky-going, celestial].

हिन्दी अर्थ

और मीन [मत्स्य] केतु के अवतार हैं। इनके अतिरिक्त जो अन्य अवतार हैं, वे भी ग्रहों से उत्पन्न (खेटज) हैं। जिनमें परमात्मांश अधिक है, वे सभी "खेचर" कहलाते हैं।

स्रोत: BPHS Ch.2, verse 7, Kashi Sanskrit Series No.220, PDF p.39 (main-text printed page 8). Sanskrit root verse read directly from page-image at 400dpi. Completes the nine-graha/nine-avatara correspondence: Sun-Rama, Moon-Krishna, Mars-Nrisimha, Mercury-Buddha, Jupiter-Vamana, Venus-Parashurama, Saturn-Kurma, Rahu-Varaha, Ketu-Meena. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जीवांशकता येषु जीवास्ते वै प्रकीर्तिताः । सूर्यादिभ्यो ग्रहेभ्यश्च परमात्मांशनिःसृताः ॥ ८ ॥

jiivaamshakataa yeshu jiivaaste vai prakiirtitaah | suuryaadibhyo grahebhyashcha paramaatmaamshanihsritaah || 8 ||

अंग्रेज़ी अर्थ

Those in whom there is [a predominance of] jīva-portion are indeed proclaimed to be jīvas [ordinary living beings]; while [the avatars] issue forth as a portion of the Paramātmā from the planets beginning with the Sun.

हिन्दी अर्थ

जिनमें जीवांश की प्रधानता है, वे ही जीव कहलाते हैं; जबकि सूर्य आदि ग्रहों से परमात्मांश ही अवतार रूप में प्रकट होता है।

स्रोत: BPHS Ch.2, verse 8, Kashi Sanskrit Series No.220, PDF p.39 (main-text printed page 8). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राम-कृष्णादयः सर्वे ह्यवतारा भवन्ति वै । तत्रैव ते विलीयन्ते पुनः कार्योत्तरे सदा ॥ ९ ॥

raama-krishnaadayah sarve hyavataaraa bhavanti vai | tatraiva te viliiyante punah kaaryottare sadaa || 9 ||

अंग्रेज़ी अर्थ

Rāma, Kṛṣṇa, and all the others indeed become avatars; and there itself [in their respective planets] they always dissolve back again, once their task is accomplished.

हिन्दी अर्थ

राम, कृष्ण आदि सभी अवतार होते हैं; परन्तु अपना कार्य पूर्ण करने के पश्चात् वे सदा उन्हीं-उन्हीं ग्रहों में पुनः विलीन हो जाते हैं।

स्रोत: BPHS Ch.2, verse 9, Kashi Sanskrit Series No.220, PDF p.39 (main-text printed page 8). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जीवांशनिःसृतास्तेषां तेभ्यो जाता नराद्यः । तेऽपि तत्रैव लीयन्ते तेऽव्यक्ते समयन्ति हि ॥ १० ॥

jiivaamshanihsritaasteshaam tebhyo jaataa naraadayah | te'pi tatraiva liiyante te'vyakte samayanti hi || 10 ||

अंग्रेज़ी अर्थ

From the jīva-portions of those [same planets] issue forth, and are born from them, human beings and others. They too dissolve back there itself, and indeed merge into the unmanifest [Paramātmā].

हिन्दी अर्थ

उन्हीं ग्रहों के जीवांश से मनुष्य आदि उत्पन्न होते हैं। वे भी वहीं विलीन हो जाते हैं, और अन्ततः अव्यक्त [परमात्मा] में समा जाते हैं।

स्रोत: BPHS Ch.2, verse 10, Kashi Sanskrit Series No.220, PDF p.39 (main-text printed page 8). Sanskrit root verse read directly from page-image at 400dpi; verse 11 begins at the very bottom of this page and continues onto the next -- deferred to the next seed batch rather than transcribed from a partial line. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

इदं ते कथितं विप्र सर्वं यस्मिन् भवेदिति । भूतान्यपि भविष्यन्ति वेत्ति सर्वज्ञतामियात् ॥ ११ ॥

idam te kathitam vipra sarvam yasmin bhavediti | bhuutaanyapi bhavishyanti vetti sarvajnataamiyaat || 11 ||

अंग्रेज़ी अर्थ

This, O Brahmin, has been told to you in full -- [this teaching] in which everything [past, present and future] is contained. One who knows things past as well as things to come attains omniscience (sarvajñatā).

हिन्दी अर्थ

हे विप्र! यह सब कुछ आपसे कह दिया गया है, जिसमें सब कुछ समाहित है। जो व्यक्ति भूत और भविष्य दोनों को जानता है, वह सर्वज्ञता को प्राप्त होता है।

स्रोत: BPHS Ch.2, verse 11, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036) -- first half ("idam te kathitam...") on PDF p.39 (printed page 8, bottom line), second half ("bhuutaanyapi...") on PDF p.40 (printed page 9, top line). Sanskrit root verse read directly from both page-images at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विना तज्ज्योतिषं नान्यो ज्ञातुं शक्नोति कहिंचित् । तस्मादवश्यमध्येयं ब्राह्मणैश्च विशेषतः ॥ १२ ॥

vinaa tajjyotisham naanyo jnaatum shaknoti kahimchit | tasmaadavashyamadhyeyam braahmanaishcha visheshatah || 12 ||

अंग्रेज़ी अर्थ

Without that science of Jyotiṣa, no one else is able to know [these matters] at all. Therefore it must necessarily be studied, and especially by Brahmins.

हिन्दी अर्थ

उस ज्योतिषशास्त्र के बिना अन्य कोई भी इन बातों को नहीं जान सकता। अतः यह शास्त्र अवश्य पढ़ना चाहिए, विशेषतः ब्राह्मणों को।

स्रोत: BPHS Ch.2, verse 12, Kashi Sanskrit Series No.220, PDF p.40 (main-text printed page 9). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यो नरः शास्त्रमज्ञात्वा ज्योतिषं खलु निन्दति । रौरवं नरकं भुक्त्वा चान्धत्वं चान्यजन्मनि ॥ १३ ॥

yo narah shaastramajnaatvaa jyotisham khalu nindati | raurabam narakam bhuktvaa chaandhatvam chaanyajanmani || 13 ||

अंग्रेज़ी अर्थ

That man who, without knowing the science, indeed disparages Jyotiṣa -- [he], having suffered the Raurava hell, [is born] blind also in another/subsequent birth.

हिन्दी अर्थ

जो मनुष्य शास्त्र को जाने बिना ही ज्योतिषशास्त्र की निन्दा करता है, वह रौरव नरक भोगकर दूसरे जन्म में अन्धा होता है।

स्रोत: BPHS Ch.2, verse 13, Kashi Sanskrit Series No.220, PDF p.40 (main-text printed page 9). Sanskrit root verse read directly from page-image at 400dpi. This page also carries Ch.2's closing colophon ("iti savimarshasudhaavyaakhyopete brihatpaaraasharahoraashaastre avataaravarnanaadhyaayah samaaptah || 2 ||"), confirming Chapter 2 is complete at 13 verses. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ ग्रहस्वरूपवर्णनाध्यायः ॥ ३ ॥ मैत्रेय उवाच— ग्रहावतारो भगवन् ! यथाऽभूत् तत्कृपालुना । यथावदुक्तं निखिलं श्रुत्वा प्रीतोऽस्मि साम्प्रतम् ॥ १ ॥

atha grahasvaruupavarnanaadhyaayah || 3 || maitreya uvaacha-- grahaavataaro bhagavan ! yathaa'bhuut tatkripaaluna | yathaavaduktam nikhilam shrutvaa priito'smi saamprataam || 1 ||

अंग्रेज़ी अर्थ

Now, the chapter describing the true nature of the planets. Maitreya said: O Lord! By your grace/compassion, [you have told] how the avatars of the planets came to be. Having heard this properly told in full, I am now pleased.

हिन्दी अर्थ

अब ग्रहस्वरूपवर्णनाध्याय आरम्भ होता है। मैत्रेय ने कहा — हे भगवन्! आपकी कृपा से ग्रहावतार जैसे हुए वैसा यथावत् सुनकर मैं अत्यन्त प्रसन्न हूँ।

स्रोत: BPHS Ch.3 opening + verse 1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.40 (main-text printed page 9). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पुनः पृच्छामि सर्वज्ञ ! ब्रूहि ग्रहगणस्य तु । गुणं रूपादिकं चैव विधिवत् प्रणताय मे ॥ २ ॥

punah pricchaami sarvajna ! bruuhi grahaganasya tu | guam ruupaadikam chaiva vidhivat pranataaya me || 2 ||

अंग्रेज़ी अर्थ

Again I ask, O omniscient one! Please tell -- duly and properly, to me who am bowed [before you] -- the qualities, forms, and so on of the group of planets.

हिन्दी अर्थ

हे सर्वज्ञ! मैं पुनः पूछता हूँ। आपके सम्मुख नतमस्तक मुझे ग्रहसमूह के गुण, रूप आदि विधिपूर्वक बताइए।

स्रोत: BPHS Ch.3, verse 2, Kashi Sanskrit Series No.220, PDF p.40 (main-text printed page 9). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पराशर उवाच— नक्षत्राणां ग्रहाणां च याहृशी नभसि स्थितिः । कथयिष्यामि तामादौ शान्तचेता निशामय ॥ ३ ॥

paraashara uvaacha-- nakshatraanaam grahaanaam cha yaadrishii nabhasi sthitih | kathayishyaami taamaadau shaantachetaa nishaamaya || 3 ||

अंग्रेज़ी अर्थ

Parāśara said: Whatever is the position, in the sky, of the nakṣatras (asterisms) and the grahas (planets) -- that I shall tell first; listen, with a peaceful mind.

हिन्दी अर्थ

पराशर ने कहा — नक्षत्रों और ग्रहों की आकाश में जैसी भी स्थिति है, वह मैं सबसे पहले बताऊँगा; शान्तचित्त होकर सुनो।

स्रोत: BPHS Ch.3, verse 3, Kashi Sanskrit Series No.220, PDF p.40 (main-text printed page 9). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तेजःपुञ्जा नु वीक्ष्यन्ते गगने रजनीषु ये । नक्षत्रसंज्ञास्ते तु न क्षरन्तीति निश्चलाः ॥ ४ ॥

tejahpunjaa nu viikshyante gagane rajaniishu ye | nakshatrasamjnaaste tu na ksharantiiti nishchalaah || 4 ||

अंग्रेज़ी अर्थ

Those masses of light (tejaḥ-puñja) which are seen in the sky during the nights -- they are termed nakṣatras, and they are fixed/motionless, in that they do not perish/wane (na kṣaranti).

हिन्दी अर्थ

रात्रि में आकाश में जो तेजपुंज दिखाई देते हैं, वे नक्षत्र कहलाते हैं; वे क्षरित (नष्ट) नहीं होते, इसलिए स्थिर (निश्चल) हैं।

स्रोत: BPHS Ch.3, verse 4, Kashi Sanskrit Series No.220, PDF p.40 (main-text printed page 9). Sanskrit root verse read directly from page-image at 400dpi. Gives a folk-etymology of "nakshatra" from na + kshar ("does not perish/decay"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विपुलाकारवन्तोऽन्ये गतिमन्तो ग्रहाः किल । स्वगत्या भानि गृह्णन्ति यतोऽतस्ते ग्रहाभिधाः ॥ ५ ॥

vipulaakaaravanto'nye gatimanto grahaah kila | svagatyaa bhaani grihnanti yato'taste grahaabhidhaah || 5 ||

अंग्रेज़ी अर्थ

The others, of vast form and possessing motion, are indeed the grahas (planets). Because they "seize"/grasp (gṛhṇanti) the stars (bhāni) by their own motion, therefore they are called "graha" [from the root grah, "to seize"].

हिन्दी अर्थ

विशाल आकार वाले तथा गतिशील अन्य पिण्ड ही ग्रह हैं। वे अपनी गति से नक्षत्रों को ग्रहण करते हैं (उनसे आगे निकल जाते हैं), इसीलिए वे "ग्रह" कहलाते हैं।

स्रोत: BPHS Ch.3, verse 5, Kashi Sanskrit Series No.220, PDF p.40 (main-text printed page 9). Sanskrit root verse read directly from page-image at 400dpi. Gives the classical etymology of "graha" from the root grah ("to seize/grasp"), contrasted with the fixed nakshatras in verse 3.4. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पूर्वामाशां व्रजन्तोऽपि प्रवहप्रेरितास्तु ते । पश्चिमस्यां दिशि सदा गच्छन्त इव भान्ति वै ॥ ६ ॥

puurvaamaashaam vrajanto'pi pravahapreritaastu te | pashchimasyaam dishi sadaa gacchanta iva bhaanti vai || 6 ||

अंग्रेज़ी अर्थ

Although they [the planets] proceed toward the eastern direction, being impelled by the pravaha [the cosmic wind], they indeed always appear as though going in the western direction.

हिन्दी अर्थ

यद्यपि वे (ग्रह) पूर्व दिशा की ओर गमन करते हैं, तथापि प्रवह वायु से प्रेरित होकर वे सदा पश्चिम दिशा में जाते हुए ही प्रतीत होते हैं।

स्रोत: BPHS Ch.3, verse 6, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.41 (main-text printed page 10), cross-verified at 900dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राशिचक्रस्य ये भागाः समाः सप्तर्द्धिसंख्यकाः । अश्विनी-भरणीत्यादि-नाम्ना ख्याता महीतले ॥ ७ ॥

raashichakrasya ye bhaagaah samaah saptarddhisamkhyakaah | ashvinii-bharaniityaadi-naamnaa khyaataa mahiitale || 7 ||

अंग्रेज़ी अर्थ

The equal divisions of the zodiac belt (rāśi-cakra), numbering [DISCLOSED, see below], are known on earth by the names beginning with Aśvinī, Bharaṇī, and so forth. [DISCLOSED: the printed compound giving the number of divisions, transcribed here letter-for-letter as "saptarddhi-samkhyakaah," does not resolve to a numeral through any bhutasankhya (number-word) convention this transcriber could confidently verify; the referent is unambiguously "27" -- confirmed both by the immediately following Hindi editorial commentary ("राशिचक्र का समान 27 विभाग अश्विनी, भरणी आदि 27 नक्षत्रों के नाम से प्रसिद्ध हैं") and by the well-known count of 27 nakṣatras -- but the exact traditional derivation of "saptarddhi" = 27 is not confirmed and should be checked against a second edition or a Sanskrit numeral-word reference in a future session.]

हिन्दी अर्थ

राशिचक्र के 27 बराबर विभाग [स्पष्टीकरण: मुद्रित शब्द-संख्या "सप्तर्द्धि" का पारम्परिक भूतसंख्या-सिद्धान्त से निश्चित अन्वय नहीं हो सका, किन्तु अर्थ निश्चित रूप से 27 है, जैसा कि तुरन्त बाद की हिन्दी टीका और 27 नक्षत्रों की सुविख्यात संख्या से पुष्ट होता है] अश्विनी, भरणी आदि नामों से पृथ्वी पर प्रसिद्ध हैं।

स्रोत: BPHS Ch.3, verse 7, Kashi Sanskrit Series No.220, PDF p.41 (main-text printed page 10), cross-verified at 900dpi crop. Numeral compound genuinely uncertain, disclosed above rather than emended. English/Hindi meanings by Vedic Hora -- for review (the edition's own Hindi commentary confirming "27" is not itself reproduced beyond the brief quoted phrase needed to support this disclosure).

संस्कृत

तदर्कमितभागास्तु ज्ञेया मेषादिनामकाः । राशयः स्युः सुविदिता ग्रहाः सूर्यादिसंज्ञकाः ॥ ८ ॥

tadarkamitabhaagaastu jneyaa meshaadinaamakaah | raashayah syuh suviditaa grahaah suuryaadisamjnakaah || 8 ||

अंग्रेज़ी अर्थ

The divisions of that same [zodiac belt], numbering "arka" [twelve -- via the traditional bhūtasaṅkhya number-word "arka" ("Sun"), which stands for 12, from the twelve Ādityas], are to be known by names beginning with Meṣa [Aries]; these are the well-known rāśis (zodiac signs). The planets (grahas) are designated by names beginning with Sūrya [the Sun].

हिन्दी अर्थ

उसी राशिचक्र के अर्कसंख्यक (बारह) विभाग मेष आदि नामों से जाने जाते हैं — ये सुविदित राशियाँ हैं। ग्रह सूर्य आदि नामों से संज्ञित हैं।

स्रोत: BPHS Ch.3, verse 8, Kashi Sanskrit Series No.220, PDF p.41 (main-text printed page 10), cross-verified at 900dpi crop. "Arka" (Sun) here functions as a bhutasankhya number-word for 12 (via the twelve Adityas), a standard Sanskrit numeral convention; confirmed against the Hindi commentary's explicit "dvaadash vibhaag" (twelve divisions). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नं भवति राशीनामुदयो यद्वशादिह । शुभं चाप्यशुभं सर्वं फलं ददति वै ग्रहाः ॥ ९ ॥

lagnam bhavati raashiinaamudayo yadvashaadiha | shubham chaapyashubham sarvam phalam dadati vai grahaah || 9 ||

अंग्रेज़ी अर्थ

The rising of the rāśis [at the horizon] is called the lagna (ascendant); under whose influence, here, the planets indeed give all results, whether auspicious or inauspicious.

हिन्दी अर्थ

राशियों का उदय ही लग्न कहलाता है; इसी लग्न के वशीभूत होकर ग्रह शुभ और अशुभ सभी फल देते हैं।

स्रोत: BPHS Ch.3, verse 9, Kashi Sanskrit Series No.220, PDF p.41 (main-text printed page 10). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नक्षत्राणां ग्रहाणां च संज्ञा ग्रन्थान्तराद् बुधैः । ज्ञेया, ग्रहा नव प्रोक्ताः सूर्याद्यास्तु खचारिणः ॥ १० ॥

nakshatraanaam grahaanaam cha samjnaa granthaantaraad budhaih | jneyaa, grahaa nava proktaah suuryaadyaastu khachaarinah || 10 ||

अंग्रेज़ी अर्थ

Other names of the nakṣatras and the grahas should be learned by the wise from other texts. The sky-moving (khacārin) planets, beginning with the Sun, are declared to be nine [in number].

हिन्दी अर्थ

नक्षत्रों और ग्रहों के अन्य नाम विद्वानों को अन्य ग्रन्थों से जानने चाहिए। सूर्य आदि आकाशचारी ग्रह नौ कहे गए हैं।

स्रोत: BPHS Ch.3, verse 10, Kashi Sanskrit Series No.220, PDF p.41 (main-text printed page 10). Sanskrit root verse read directly from page-image at 400dpi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तत्रार्कभौमशनयो राहुकेतू निशाधिपः । क्षीणश्चैते सदा पापाः, पापः पापयुतो बुधः ॥ ११ ॥

tatraarkabhaumashanayo raahuketuu nishaadhipah | kshiinashchaite sadaa paapaah, paapah paapayuto budhah || 11 ||

अंग्रेज़ी अर्थ

Among these, the Sun, Mars and Saturn, Rāhu and Ketu, and the Moon (niśādhipa, "lord of night") when waning (kṣīṇa) -- these are always malefic (pāpa). Mercury, [otherwise neutral,] is malefic when joined with a malefic [planet].

हिन्दी अर्थ

इनमें सूर्य, मंगल, शनि, राहु, केतु तथा क्षीण चन्द्रमा — ये सदा पापग्रह हैं। पापग्रह से युक्त बुध भी पापी हो जाता है।

स्रोत: BPHS Ch.3, verse 11, Kashi Sanskrit Series No.220, PDF p.41 (main-text printed page 10), cross-verified at 900dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शेषाः सौम्यग्रहाः सन्ति सौम्याऽसौम्याः शुभाऽशुभाः । त्रिकोणत्रिषडायेशा विशेषात्तु शुभाऽशुभाः ॥ १२ ॥

sheshaah saumyagrahaah santi saumyaa'saumyaah shubhaa'shubhaah | trikonatrishadaayeshaa visheshaattu shubhaa'shubhaah || 12 ||

अंग्रेज़ी अर्थ

The remaining [planets] are benefic (saumya) planets. [Thus the planets are] benefic and malefic, [and their results correspondingly] auspicious and inauspicious. The lords of the trikoṇa [trine houses] and of the tri-ṣaḍ-āya [3rd, 6th, and 11th houses] are, in particular, [respectively] auspicious and inauspicious.

हिन्दी अर्थ

शेष ग्रह सौम्य (शुभ) ग्रह हैं। इस प्रकार ग्रह सौम्य और असौम्य, शुभ और अशुभ होते हैं। त्रिकोण (5, 9) तथा त्रिषडाय (3, 6, 11) भावों के स्वामी विशेष रूप से क्रमशः शुभ और अशुभ फलदायक होते हैं।

स्रोत: BPHS Ch.3, verse 12, Kashi Sanskrit Series No.220, PDF p.41 (main-text printed page 10), cross-verified at 900dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दिवाकरो हि विश्वात्मा मनः कुमुद्वान्धवः । सत्त्वं कुजो बुधो वाणीदायको विबुधैः स्मृतः ॥ १३ ॥

divaakaro hi vishvaatmaa manah kumudvaandhavah | sattvam kujo budho vaaniidaayako vibudhaih smritah || 13 ||

अंग्रेज़ी अर्थ

The Sun indeed is the soul of the universe (viśvātmā); the Moon (kumud-vāndhava, "friend of the water-lilies") is the mind. Mars is courage/strength (sattva); Mercury is remembered by the wise as the giver of speech.

हिन्दी अर्थ

सूर्य समस्त विश्व की आत्मा है; चन्द्रमा (कुमुद्बान्धव) मन है। मंगल साहस (सत्त्व) है; बुध को विद्वानों ने वाणी का दाता कहा है।

स्रोत: BPHS Ch.3, verse 13, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.42 (main-text printed page 11), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review (the edition's own Hindi prose commentary is not reproduced, per copyright policy).

संस्कृत

देवेज्यो ज्ञानसुखदो भृगुर्वीर्यप्रदायकः । क्रूरदृग् विबुधैरुक्तश्छायापुत्रश्च दुःखदः ॥ १४ ॥

devejyo jnaanasukhado bhrigurviiryapradaayakah | kruuradrig vibudhairuktashchhaayaaputrashcha duhkhadah || 14 ||

अंग्रेज़ी अर्थ

Jupiter (devejya) is the giver of knowledge and happiness; Venus (bhṛgu) is the giver of vitality. Saturn (chāyā-putra, "son of Chāyā") is said by the wise to have a cruel gaze/glance, and is the giver of sorrow.

हिन्दी अर्थ

गुरु (देवेज्य) ज्ञान और सुख का दाता है; शुक्र (भृगु) वीर्य (बल) का दाता है। छायापुत्र शनि को विद्वानों ने क्रूर दृष्टि वाला तथा दुःखदायक कहा है।

स्रोत: BPHS Ch.3, verse 14, Kashi Sanskrit Series No.220, PDF p.42 (main-text printed page 11), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राजानौ भानुहिमगू नेता ज्ञेयो धरात्मजः । बुधो राजकुमारश्च सचिवौ गुरुभार्गवौ ॥ १५ ॥

raajaanau bhaanuhimaguu netaa jneyo dharaatmajah | budho raajakumaarashcha sachivau gurubhaargavau || 15 ||

अंग्रेज़ी अर्थ

The Sun and the Moon (bhānu-himagu) are to be known as the two kings; Mars (dharātmaja, "son of the Earth") is the commander (netā); Mercury is the prince; Jupiter and Venus (bhārgava) are the two ministers.

हिन्दी अर्थ

सूर्य और चन्द्रमा (भानु-हिमगु) दोनों राजा जानने चाहिए; मंगल (धरात्मज) सेनापति है; बुध राजकुमार है; गुरु और शुक्र (भार्गव) दोनों मन्त्री हैं।

स्रोत: BPHS Ch.3, verse 15, Kashi Sanskrit Series No.220, PDF p.42 (main-text printed page 11), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्रेष्यको रविपुत्रश्च सेना स्वर्भानुपुच्छकौ । एवं क्रमेण वै विप्र ! सूर्यादींस्तु विचिन्तयेत् ॥ १६ ॥

preshyako raviputrashcha senaa svarbhaanupuchchhakau | evam kramena vai vipra ! suuryaadiimstu vichintayet || 16 ||

अंग्रेज़ी अर्थ

Saturn (ravi-putra, "son of the Sun") is the servant; Svarbhānu and its tail [Rāhu and Ketu] are the army. Thus, O Brahmin, one should reflect on the Sun and the other planets in this order [of rank].

हिन्दी अर्थ

शनि (रविपुत्र) सेवक है; स्वर्भानु और उसकी पूँछ [राहु-केतु] सेना हैं। हे विप्र! इसी क्रम से सूर्यादि ग्रहों का चिन्तन करना चाहिए।

स्रोत: BPHS Ch.3, verse 16, Kashi Sanskrit Series No.220, PDF p.42 (main-text printed page 11), read from 400dpi full-page render. This page carries the editorial Hindi subheadings "grahon kii aatmaadi samjnaa", "grahon kii raajaadi samjnaa", "grahon kaa varna", and "grahon ke deva" -- these are the modern editor's structural headings, not part of the ancient text, and are not transcribed, per established policy. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रक्तश्यामो दिवाधीशो गौरगात्रो निशाकरः । नातिदीर्घः कुजो रक्तो दूर्वाश्यामो बुधस्तथा ॥ १७ ॥

raktashyaamo divaadhiisho gauragaatro nishaakarah | naatidiirghah kujo rakto duurvaashyaamo budhastathaa || 17 ||

अंग्रेज़ी अर्थ

The Sun (divādhīśa) is reddish-dark; the Moon (niśākara) is fair-bodied. Mars, not very tall, is red; Mercury likewise is dark-green, like dūrvā grass.

हिन्दी अर्थ

सूर्य (दिवाधीश) रक्त-श्याम है; चन्द्रमा (निशाकर) गौरशरीर है। मंगल, अधिक लम्बा नहीं, लाल है; बुध भी दूर्वा के समान श्यामवर्ण है।

स्रोत: BPHS Ch.3, verse 17, Kashi Sanskrit Series No.220, PDF p.42 (main-text printed page 11), read from 400dpi full-page render, cross-verified at 900dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गौरगात्रो गुरुर्ज्ञेयः शुक्रः श्यामस्तथैव च । कृष्णदेहो रवेः पुत्रो जायते द्विजसत्तम ! ॥ १८ ॥

gauragaatro gururjneyah shukrah shyaamastathaiva cha | krishnadeho raveh putro jaayate dvijasattama ! || 18 ||

अंग्रेज़ी अर्थ

Jupiter is to be known as fair-bodied; Venus is likewise dark. O best of Brahmins! The son of the Sun [Saturn] is born with a black body.

हिन्दी अर्थ

गुरु गौरशरीर जानना चाहिए; शुक्र भी श्यामवर्ण है। हे द्विजश्रेष्ठ! सूर्यपुत्र (शनि) कृष्णवर्ण शरीर वाला उत्पन्न होता है।

स्रोत: BPHS Ch.3, verse 18, Kashi Sanskrit Series No.220, PDF p.42 (main-text printed page 11), read from 400dpi full-page render, cross-verified at 900dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वह्नचम्बुशिखिजा विष्णु-विडौजः शचिका द्विज ! । सूर्यादीनां खगानां तु देवा ज्ञेयाः क्रमेण च ॥ १९ ॥

vahnichambushikhijaa vishnu-vidaujah shachikaa dvija ! | suuryaadiinaam khagaanaam tu devaa jneyaah kramena cha || 19 ||

अंग्रेज़ी अर्थ

Agni [fire], water, and Śikhijā [Kārtikeya, "born of fire"] [DISCLOSED, see below]; Viṣṇu and Vidaujas [Indra]; Śacī [Indrāṇī] -- O Brahmin! -- these, in order, should be known as the deities of the Sun and the other sky-moving planets. [DISCLOSED: the first line is transcribed here letter-for-letter as printed, "vahnichambushikhijaa vishnu-vidaujah shachikaa"; this transcriber reads it as intending the compound "vahni-ambu-shikhijaa" (Agni, water, Kārtikeya), based on this scan's characteristically tight kerning and confirmed in sense by the immediately following Hindi editorial commentary, which glosses this verse as naming Agni, Jal (water), Kārtikeya, Viṣṇu, Indra, and Indrāṇī -- but the exact printed sandhi form is not fully certain and should be checked against a second edition in a future session. Separately: the Hindi commentary supplies a seventh deity, Brahmā, for Saturn -- but no such name appears in the visible root-verse text transcribed above, which names only six deities; the deity of Saturn (and, by extension, Rāhu/Ketu) is therefore left unstated in this verse itself and is supplied only by tradition/commentary, not reproduced here as part of the root verse.]

हिन्दी अर्थ

अग्नि, जल तथा शिखिजा [कार्त्तिकेय] [स्पष्टीकरण नीचे देखें]; विष्णु और विडौजः [इन्द्र]; शचि [इन्द्राणी] — हे द्विज! — सूर्यादि आकाशचारी ग्रहों के देव क्रमशः इसी प्रकार जानने चाहिए। [स्पष्टीकरण: प्रथम पंक्ति का मुद्रित रूप "वह्नचम्बुशिखिजा विष्णु-विडौजः शचिका" अक्षरशः पढ़ा गया है; इसका आशय "वह्नि-अम्बु-शिखिजा" (अग्नि, जल, कार्त्तिकेय) प्रतीत होता है, जो आगे की हिन्दी टीका से अर्थतः पुष्ट होता है, किन्तु ठीक मुद्रित सन्धि-रूप निश्चित नहीं है। इसके अतिरिक्त, हिन्दी टीका शनि के लिए सातवें देवता "ब्रह्मा" का उल्लेख करती है, जो इस दृश्यमान मूल श्लोक में नहीं है — मूल श्लोक में केवल छह देवता ही नामित हैं।]

स्रोत: BPHS Ch.3, verse 19, Kashi Sanskrit Series No.220, PDF p.42 (main-text printed page 11), read from 400dpi full-page render, cross-verified at 900dpi crop (bphs-ch3-v19line3.png). Genuine textual/interpretive ambiguity disclosed above rather than silently resolved -- the printed compound's exact sandhi form, and the mismatch between the verse's six named deities and the commentary's seven, are both flagged for future cross-checking against a second edition. English/Hindi meanings by Vedic Hora -- for review (the edition's own Hindi commentary is not reproduced beyond the brief paraphrase needed to support this disclosure).

संस्कृत

क्लीबौ द्वौ सौम्यशौरी च [उभयतः अनिश्चित, टिप्पणी देखें] । नराः शेषाश्च विज्ञेया भानुभौमो गुरुस्तथा ॥ २० ॥

kliibau dvau saumyashaurii cha [DISCLOSED, see note] | naraah sheshaashcha vijneyaa bhaanubhaumo gurustathaa || 20 ||

अंग्रेज़ी अर्थ

The two neuter ones are Saumya [Mercury] and Śauri [Saturn -- this epithet, initially disclosed as uncertain, is now confirmed: verse 3.30 below uses this same name "Śauri" unambiguously for Saturn] -- [DISCLOSED: the remainder of this first line, expected to name the female pair, is not confidently resolved -- see note]. The remaining [planets] are to be known as male: the Sun, Mars, and likewise Jupiter. [DISCLOSED: this verse's first line is genuinely difficult in this scan -- a watermark stamp overlaps part of the line. The clearly legible portion reads "kliibau dvau saumyashaurii cha" ("the two neuter ones are Saumya [Mercury] and Śauri [Saturn]") -- "Śauri" as this text's own epithet for Saturn is confirmed by verse 3.30's unambiguous use of the same name. The remainder of the line, expected on grammatical and doctrinal grounds to name the Moon and Venus as the female pair (as confirmed by the Hindi commentary on this page: "chandra-shukra strii"), could not be confidently read letter-for-letter due to overlapping watermark ink, and is therefore omitted here rather than reconstructed from the expected sense. The overall doctrine -- Mercury & Saturn neuter, Moon & Venus female, Sun/Mars/Jupiter male -- is independently confirmed by that same commentary and by verse 20's own clearly-legible second line.]

हिन्दी अर्थ

दोनों नपुंसक हैं — सौम्य [बुध] तथा शौरि [शनि — यह नाम श्लोक ३.३० में शनि हेतु स्पष्ट रूप से प्रयुक्त होने से अब पुष्ट है] । [स्पष्टीकरण: पंक्ति का शेष भाग, जो चन्द्र-शुक्र (स्त्रीलिंग) का उल्लेख करता प्रतीत होता है, वाटरमार्क की स्याही से ढका होने के कारण अक्षरशः नहीं पढ़ा जा सका।] शेष ग्रह पुरुष जानने चाहिए — सूर्य, मंगल, तथा गुरु।

स्रोत: BPHS Ch.3, verse 20, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036) -- first line at the very bottom of PDF p.42 (printed page 11, obscured in part by the eGangotri watermark stamp baked into the scan), second line at the top of PDF p.43 (printed page 12). Cross-verified at 1400dpi and 2000dpi crops (bphs-ch3-v20-left.png, bphs-ch3-v20-right.png). The epithet "Shauri" for Saturn, initially flagged as uncertain, is confirmed by its unambiguous reuse in verse 3.30. The female-pair portion of the line remains genuinely obscured by watermark overlap and is disclosed rather than reconstructed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अग्नि-भूमि-नभस्तोय-वायवः क्रमतो द्विज । भौमादीनां ग्रहाणां तु तत्त्वान्येतानि वै क्रमात् ॥ २१ ॥

agni-bhuumi-nabhastoya-vaayavah kramato dvija | bhaumaadiinaam grahaanaam tu tattvaanyetaani vai kramaat || 21 ||

अंग्रेज़ी अर्थ

Fire, earth, ether/sky, water, and air -- in this order, O Brahmin. These indeed are, in order, the elements (tattvas) of the planets beginning with Mars [i.e. Mars=fire, Mercury=earth, Jupiter=ether, Venus=water, Saturn=air].

हिन्दी अर्थ

अग्नि, भूमि, आकाश, जल तथा वायु — इसी क्रम से, हे द्विज! ये मंगल आदि ग्रहों के क्रमशः तत्त्व हैं [अर्थात् मंगल=अग्नि, बुध=भूमि, गुरु=आकाश, शुक्र=जल, शनि=वायु]।

स्रोत: BPHS Ch.3, verse 21, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review (the edition's own Hindi prose commentary confirming this same correspondence is not reproduced, per copyright policy).

संस्कृत

गुरुशुक्रौ विप्रवर्णौ कुजार्कौ क्षत्रियौ द्विज ! । शशिसौम्यौ वैश्यवर्णौ शनिः शूद्रो द्विजोत्तम ॥ २२ ॥

gurushukrau vipravarnau kujaarkau kshatriyau dvija ! | shashisaumyau vaishyavarnau shanih shuudro dvijottama || 22 ||

अंग्रेज़ी अर्थ

Jupiter and Venus are of the Brahmin varna; Mars and the Sun, O Brahmin, are Kshatriya. The Moon and Mercury are of the Vaishya varna; Saturn is Shudra, O best of Brahmins.

हिन्दी अर्थ

गुरु और शुक्र ब्राह्मण वर्ण के हैं; मंगल और सूर्य, हे द्विज! क्षत्रिय हैं। चन्द्रमा और बुध वैश्य वर्ण के हैं; शनि शूद्र है, हे द्विजोत्तम!

स्रोत: BPHS Ch.3, verse 22, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render, cross-verified at 1400dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

साच्विका भानुचन्द्रेज्या राजसौ सौम्यभार्गवौ । तामसौ कुजमन्दौ तु ज्ञेया विद्वद्धरैः सदा ॥ २३ ॥

saachvikaa bhaanuchandrejyaa raajasau saumyabhaargavau | taamasau kujamandau tu jneyaa vidvaddharaih sadaa || 23 ||

अंग्रेज़ी अर्थ

The Sun, Moon, and Jupiter are sāttvic; Mercury and Venus (bhārgava) are rājasic. Mars and Saturn (manda), on the other hand, should always be known by the wise as tāmasic.

हिन्दी अर्थ

सूर्य, चन्द्रमा तथा गुरु सात्त्विक हैं; बुध और शुक्र (भार्गव) राजसिक हैं। मंगल और शनि (मन्द) को विद्वानों द्वारा सदा तामसिक जानना चाहिए।

स्रोत: BPHS Ch.3, verse 23, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render. This closes the section on planetary varna/guna; the section "grahon kaa svaruup" (the physical form of the planets) follows starting verse 24. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मधुपिङ्गलदृक् सूर्यश्चतुरस्रः शुचिर्द्विज ! । पित्तप्रकृतिको धीमान् पुमानल्पकचो द्विज ! ॥ २४ ॥

madhupingaladrik suuryashchaturasrah shuchirdvija ! | pittaprakritiko dhiimaan pumaanalpakacho dvija ! || 24 ||

अंग्रेज़ी अर्थ

The Sun has honey-tawny (madhu-piṅgala) eyes, is square/quadrangular (chaturasra) in shape, and is pure (śuchi), O Brahmin. He is of bilious (pitta) constitution, wise (dhīmān), male (pumān), and has little hair (alpa-kacha), O Brahmin.

हिन्दी अर्थ

सूर्य के नेत्र मधु के समान पिंगल (भूरे) हैं; वे चतुष्कोण आकार के हैं; हे द्विज! वे शुचि (पवित्र) हैं। वे पित्तप्रकृति, बुद्धिमान्, पुरुष तथा अल्पकेश वाले हैं, हे द्विज!

स्रोत: BPHS Ch.3, verse 24, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.43 (main-text printed page 12), read from 400dpi full-page render, cross-verified at 1400dpi crop. This opens the section "grahon kaa svaruup" (the physical form of the planets). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

बहुवातकफः प्राज्ञश्चन्द्रो वृत्ततनुर्द्विज ! । शुभदृड् मधुवाक्यश्च चञ्चलो मदनातुरः ॥ २५ ॥

bahuvaatakaphah praajnashchandro vrittatanurdvija ! | shubhadrig madhuvaakyashcha chanchalo madanaaturah || 25 ||

अंग्रेज़ी अर्थ

The Moon has abundant vāta and kapha [in constitution], is wise (prājña), and round-bodied (vṛttatanu), O Brahmin. He has an auspicious gaze, sweet speech, is fickle (chañchala), and is afflicted by desire/love (madanātura).

हिन्दी अर्थ

चन्द्रमा में वात और कफ की अधिकता है; वे प्राज्ञ (बुद्धिमान्) तथा गोलाकार शरीर वाले हैं, हे द्विज! उनकी दृष्टि शुभ है, वाणी मधुर है, वे चंचल हैं तथा कामातुर (प्रेमासक्त) हैं।

स्रोत: BPHS Ch.3, verse 25, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रक्ताक्षः क्रूरहृद् भौमश्चपलोदारमूर्तिकः । पित्तप्रकृतिकः क्रोधी कृशमध्यतनुर्द्विज ! ॥ २६ ॥

raktaakshah kruurahrid bhaumashchapalodaaramuurtikah | pittaprakritikah krodhii krishamadhyatanurdvija ! || 26 ||

अंग्रेज़ी अर्थ

Mars is red-eyed, cruel-hearted, fickle, and of a noble/generous form (udāra-mūrti). He is of bilious (pitta) constitution, wrathful (krodhī), and slender-waisted (kṛśa-madhya-tanu), O Brahmin.

हिन्दी अर्थ

मंगल रक्तनेत्र, क्रूरहृदय, चपल तथा उदार शरीर वाले हैं। वे पित्तप्रकृति, क्रोधी तथा कृशमध्य (पतली कमर वाले) शरीर के हैं, हे द्विज!

स्रोत: BPHS Ch.3, verse 26, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वपुः श्रेष्ठः श्लिष्टवाक् च ह्यतिहास्यरुचिर्बुधः । पित्तवान् कफवान् विप्र ! मारुतप्रकृतिस्तथा ॥ २७ ॥

vapuh shreshthah shlishtavaak cha hyatihaasyaruchirbudhah | pittavaan kaphavaan vipra ! maarutaprakritistathaa || 27 ||

अंग्रेज़ी अर्थ

Mercury has an excellent body, coherent/well-composed speech, and is exceedingly fond of wit and laughter. He has pitta and kapha [in constitution], O Brahmin, and likewise a vāta (māruta) constitution.

हिन्दी अर्थ

बुध का शरीर उत्तम है, वाणी सुसंबद्ध है, तथा वे अत्यधिक हास्यप्रिय हैं। उनमें पित्त और कफ है, हे विप्र! तथा वात (मारुत) प्रकृति भी है।

स्रोत: BPHS Ch.3, verse 27, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render, cross-verified at 1400dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

बृहद्गात्रो गुरुश्चैव पिङ्गलो मूर्धजेक्षणः । कफप्रकृतिको धीमान् सर्वशास्त्रविशारदः ॥ २८ ॥

brihadgaatro gurushchaiva pingalo muurdhajekshanah | kaphaprakritiko dhiimaan sarvashaastravishaaradah || 28 ||

अंग्रेज़ी अर्थ

Jupiter has a large body, is tawny (piṅgala), and is "mūrdhajekṣaṇa" [DISCLOSED: literally "hair-eyed" -- the precise sense of this compound, likely describing hair growing low toward the eyes/brow, is not fully certain to this transcriber and is given here without embellishment]. He is of phlegmatic (kapha) constitution, wise, and learned in all the scriptures.

हिन्दी अर्थ

गुरु का शरीर बड़ा है, वे पिंगलवर्ण हैं, तथा "मूर्धजेक्षण" (शाब्दिक अर्थ: "केश-नेत्र") हैं [स्पष्टीकरण: इस समास का ठीक अभिप्राय निश्चित नहीं है]। वे कफप्रकृति, बुद्धिमान् तथा सभी शास्त्रों में निपुण हैं।

स्रोत: BPHS Ch.3, verse 28, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render, cross-verified at 1400dpi crop. The compound "muurdhajekshana" is transcribed exactly as printed; its precise interpretive sense is disclosed as uncertain rather than embellished. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मुखी कान्तवपुः श्रेष्ठः सुन्दराक्षो भृगोः सुतः । कफाधिकानिलात्मा च काव्यकृद् वक्रमूर्धजः ॥ २९ ॥

mukhii kaantavapuh shreshthah sundaraaksho bhrigoh sutah | kaphaadhikaanilaatmaa cha kaavyakrid vakramuurdhajah || 29 ||

अंग्रेज़ी अर्थ

Venus (bhṛgoḥ suta, "son of Bhṛgu") has a [handsome] face, an excellent and lovely body, and beautiful eyes. He is predominantly of kapha and vāta constitution, a composer of poetry (kāvyakṛt), and curly-haired (vakra-mūrdhaja).

हिन्दी अर्थ

शुक्र (भृगु-पुत्र) का मुख [सुन्दर] है, शरीर उत्तम एवं मनोहर है, नेत्र सुन्दर हैं। वे कफ-वातप्रधान प्रकृति के, काव्य के रचयिता तथा घुँघराले बालों वाले हैं।

स्रोत: BPHS Ch.3, verse 29, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render, cross-verified at 1400dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कृशदीर्घतनुः शौरिः पिङ्गदृष्ट्यनिलात्मकः । स्थूलदन्तोऽलसः पङ्गुः खररोमकचो द्विज ! ॥ ३० ॥

krishadiirghatanuh shaurih pingadrishtyanilaatmakah | sthuuladanto'lasah pangu khararomakacho dvija ! || 30 ||

अंग्रेज़ी अर्थ

Saturn (Śauri) is lean and long-bodied, tawny-eyed (piṅga-dṛṣṭi), and of an airy (anila/vāta) constitution. He has large/thick teeth, is lazy (alasa), lame (paṅgu), and has coarse hair (khara-roma-kacha), O Brahmin.

हिन्दी अर्थ

शनि (शौरि) कृश एवं दीर्घ शरीर वाले हैं, उनकी दृष्टि पिंगलवर्ण है, तथा वे वातप्रकृति के हैं। उनके दाँत बड़े हैं, वे आलसी, पंगु (लंगड़े) तथा रूखे-कठोर बालों वाले हैं, हे द्विज!

स्रोत: BPHS Ch.3, verse 30, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render, cross-verified at 1400dpi crop. This verse's use of "Shauri" for Saturn confirms the same epithet's identity, initially disclosed as uncertain, in verse 3.20. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धूम्राकारो नीलतनुर्वनस्थोऽपि भयङ्करः । वातप्रकृतिको धीमान् स्वभानुस्तादृशः शिखी ॥ ३१ ॥

dhuumraakaaro niilatanurvanastho'pi bhayankarah | vaataprakritiko dhiimaan svabhaanustaadrishah shikhii || 31 ||

अंग्रेज़ी अर्थ

Svabhānu [Rāhu] is smoky in form (dhūmrākāra), dark-bodied (nīlatanu), forest-dwelling, and frightening (bhayaṅkara); he is of airy (vāta) constitution and wise. Śikhī [Ketu, "the crested/flame-bannered one"] is likewise (tādṛśa) [described in the same way].

हिन्दी अर्थ

स्वभानु [राहु] धूम्र (धुएँ के समान) आकार वाले, नीलवर्ण शरीर वाले, वनवासी तथा भयंकर हैं; वे वातप्रकृति के तथा बुद्धिमान् हैं। शिखी [केतु] भी तादृश (इसी प्रकार के) हैं।

स्रोत: BPHS Ch.3, verse 31, Kashi Sanskrit Series No.220, PDF p.43 (main-text printed page 12), read from 400dpi full-page render, cross-verified at 1400dpi crop. This verse concludes the "grahon kaa svaruup" section, covering the physical form of all nine grahas; Ketu's description is stated to match Rahu's rather than being separately elaborated. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अस्थि रक्तस्तथा मज्जा त्वङ्मेदो वीर्यमेव च । स्नायुरेते धातवः स्युः सूर्यादीनां क्रमाद् द्विज ! ॥ ३२ ॥

asthi raktastathaa majjaa tvangmedo viiryameva cha | snaayurete dhaatavah syuh suuryaadiinaam kramaad dvija ! || 32 ||

अंग्रेज़ी अर्थ

Bone, blood, marrow, skin, fat, and semen (vitality), and sinew -- these are, in order, the bodily tissues (dhātus) of the Sun and the rest [i.e. Sun=bone, Moon=blood, Mars=marrow, Mercury=skin, Jupiter=fat, Venus=semen, Saturn=sinew], O Brahmin.

हिन्दी अर्थ

हड्डी, रक्त, मज्जा, त्वचा, मेद तथा वीर्य एवं स्नायु — ये सूर्यादि ग्रहों के क्रमशः धातु हैं [अर्थात् सूर्य=हड्डी, चन्द्र=रक्त, मंगल=मज्जा, बुध=त्वचा, गुरु=मेद, शुक्र=वीर्य, शनि=स्नायु], हे द्विज!

स्रोत: BPHS Ch.3, verse 32, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.44 (main-text printed page 13), 400dpi full-page render cross-verified at 1400dpi crop. This opens the new section "suuryaadigrahon ke dhaatu aadi" (dhatus etc. of the planets from the Sun onward). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

देवालय-पयोवह्निक्रीडादीनां तथैव च । कोश-शय्याघुत्करणामीशाः सूर्यादयः क्रमात् ॥ ३३ ॥

devaalaya-payovahnikriidaadiinaam tathaiva cha | kosha-shayyaa[DISCLOSED, see note]karanaamiishaah suuryaadayah kramaat || 33 ||

अंग्रेज़ी अर्थ

Likewise, the Sun and the rest are, in order, the lords of: temple, reservoir (water), fireplace, and playground, and so forth -- [and further, of] treasury, bedroom, and [DISCLOSED: the printed compound here, transcribed letter-for-letter as "...shayyaaghutkaranaam...", does not cleanly resolve; the intended word is almost certainly "utkara" (refuse-heap/dunghill), confirmed by this page's own Hindi commentary, which glosses this exact place as "utkara (kuudaa-karkat-khaanaa)" -- "refuse-heap (a garbage place)". Transcribed as printed rather than silently emended.] [i.e. Sun=temple, Moon=reservoir, Mars=fireplace, Mercury=playground, Jupiter=treasury, Venus=bedroom, Saturn=refuse-heap].

हिन्दी अर्थ

इसी प्रकार सूर्यादि ग्रह क्रमशः मन्दिर, जलाशय, अग्नि-स्थान तथा क्रीड़ास्थल के, एवं कोश (खजाना), शय्या (शयनगृह) तथा [स्पष्टीकरण: मुद्रित शब्द का अंतिम भाग स्पष्ट नहीं है, किन्तु हिन्दी टीका इसे "उत्कर (कूड़ा-कर्कट-खाना)" बताती है] के स्वामी हैं [अर्थात् सूर्य=मन्दिर, चन्द्र=जलाशय, मंगल=अग्नि-स्थान, बुध=क्रीड़ास्थल, गुरु=कोश, शुक्र=शय्या, शनि=उत्कर]।

स्रोत: BPHS Ch.3, verse 33, Kashi Sanskrit Series No.220, PDF p.44 (main-text printed page 13), cross-verified at 2000dpi crops (bphs-ch3-v33word.png, bphs-ch3-v33bword.png). The final compound is a genuinely uncertain, tightly-kerned print; transcribed as printed with the commentary-confirmed intended sense disclosed rather than reconstructed as the root text. English/Hindi meanings by Vedic Hora -- for review (the edition's own commentary phrase is only briefly quoted to support this disclosure, per copyright policy).

संस्कृत

अयनक्षणवारर्तु-मासपक्षसमा द्विज ! । सूर्यादीनां क्रमाज्ज्ञेया निर्विशङ्कं द्विजोत्तम ! ॥ ३४ ॥

ayanakshanavaarartu-maasapakshasamaa dvija ! | suuryaadiinaam kramaajjneyaa nirvishankam dvijottama ! || 34 ||

अंग्रेज़ी अर्थ

The ayana (solstice-half), kshaṇa (moment), vāra (weekday), ṛtu (season), māsa (month), pakṣa (fortnight), and year, O Brahmin -- these should be known, without any doubt, as belonging in order to the Sun and the rest [i.e. Sun=ayana, Moon=kshana, Mars=vaara, Mercury=rtu, Jupiter=maasa, Venus=paksha, Saturn=year], O best of Brahmins.

हिन्दी अर्थ

अयन, क्षण, वार, ऋतु, मास, पक्ष तथा वर्ष, हे द्विज! ये निःसंदेह सूर्यादि ग्रहों के क्रमशः जानने चाहिए [अर्थात् सूर्य=अयन, चन्द्र=क्षण, मंगल=वार, बुध=ऋतु, गुरु=मास, शुक्र=पक्ष, शनि=वर्ष], हे द्विजोत्तम!

स्रोत: BPHS Ch.3, verse 34, Kashi Sanskrit Series No.220, PDF p.44 (main-text printed page 13), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कटुश्च लवणस्तिक्तो मिश्रितो मधुरोऽम्लकः । कषायः क्रमशो ज्ञेयाः सूर्यादीनामिमे रसाः ॥ ३५ ॥

katushcha lavanastikto mishrito madhuro'mlakah | kashaayah kramasho jneyaah suuryaadiinaamime rasaah || 35 ||

अंग्रेज़ी अर्थ

Pungent, salty, bitter, mixed, sweet, sour, and astringent -- these are to be known, in order, as the tastes (rasas) of the Sun and the rest [i.e. Sun=pungent, Moon=salty, Mars=bitter, Mercury=mixed, Jupiter=sweet, Venus=sour, Saturn=astringent].

हिन्दी अर्थ

कटु, लवण, तिक्त, मिश्रित, मधुर, अम्ल तथा कषाय — ये क्रमशः सूर्यादि ग्रहों के रस जानने चाहिए [अर्थात् सूर्य=कटु, चन्द्र=लवण, मंगल=तिक्त, बुध=मिश्रित, गुरु=मधुर, शुक्र=अम्ल, शनि=कषाय]।

स्रोत: BPHS Ch.3, verse 35, Kashi Sanskrit Series No.220, PDF p.44 (main-text printed page 13), cross-verified at 1400dpi crop. This concludes the dhatu/place/time/rasa section. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

बुधेज्यौ बलिनौ पूर्वे, रविभौमौ च दक्षिणे । वारुणे सूर्यपुत्रश्च सितचन्द्रौ तथोत्तरे ॥ ३६ ॥

budhejyau balinau puurve, ravibhaumau cha dakshine | vaarune suuryaputrashcha sitachandrau tathottare || 36 ||

अंग्रेज़ी अर्थ

Mercury and Jupiter are strong in the East; the Sun and Mars in the South. In the Varuna [western] direction, the son of the Sun [i.e. Saturn]; and likewise Venus and the Moon in the North [are strong].

हिन्दी अर्थ

बुध और गुरु पूर्व दिशा में बलवान् हैं; सूर्य और मंगल दक्षिण में। वरुण दिशा (पश्चिम) में सूर्यपुत्र [अर्थात् शनि], तथा उत्तर दिशा में शुक्र और चन्द्रमा बलवान् होते हैं।

स्रोत: BPHS Ch.3, verse 36, Kashi Sanskrit Series No.220, PDF p.44 (main-text printed page 13), cross-verified at 1400dpi crop. This opens the new section "grahon ke dik-kaal, bal" (the direction, time, and strength of the planets). "Suryaputra" (son of the Sun) is this text's own epithet for Saturn. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

निशायां बलिनश्चन्द्र-बुध-सौरा भवन्ति हि । सर्वदा ज्यो वली ज्ञेयो दिने शेषा द्विजोत्तम ! ॥ ३७ ॥

nishaayaam balinashchandra-budha-sauraa bhavanti hi | sarvadaa jyo valii jneyo dine sheshaa dvijottama ! || 37 ||

अंग्रेज़ी अर्थ

At night, the Moon, Mercury, and Saturn indeed become strong. Jupiter is to be known as always strong; the rest [Sun, Mars, Venus are strong] by day, O best of Brahmins.

हिन्दी अर्थ

रात्रि में चन्द्रमा, बुध तथा शनि बलवान् होते हैं। गुरु को सदा बलवान् जानना चाहिए; शेष [सूर्य, मंगल, शुक्र] दिन में बलवान् होते हैं, हे द्विजोत्तम!

स्रोत: BPHS Ch.3, verse 37, Kashi Sanskrit Series No.220, PDF p.44 (main-text printed page 13), read from 400dpi full-page render. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कृष्णे च बलिनः क्रूराः सौम्या वीर्ययुता सिते । सौम्यायने सौम्यखेटो बली याम्यायनेऽपरः ॥ ३८ ॥

krishne cha balinah kruuraah saumyaa viiryayutaa site | saumyaayane saumyakheto balii yaamyaayane'parah || 38 ||

अंग्रेज़ी अर्थ

In the dark fortnight (Kṛṣṇa-pakṣa), the cruel [malefic planets] are strong; in the bright [fortnight] (Śukla-pakṣa), the benefics are endowed with vitality. In the northern course (Uttarāyaṇa), the benefic planets are strong; in the southern course (Dakṣiṇāyana), the others [the malefics are strong].

हिन्दी अर्थ

कृष्ण पक्ष में क्रूर (पाप) ग्रह बलवान् होते हैं; शुक्ल पक्ष में सौम्य (शुभ) ग्रह वीर्ययुक्त होते हैं। उत्तरायण में सौम्य ग्रह बलवान् होते हैं; दक्षिणायन में शेष (पाप ग्रह) बलवान् होते हैं।

स्रोत: BPHS Ch.3, verse 38, Kashi Sanskrit Series No.220, PDF p.44 (main-text printed page 13), cross-verified at 1400dpi crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अब्द-मास-दिवा-होराऽधीशास्तु वलवत्तराः । श. भौ. बु. गु. शु. सोराद्या वृद्धितो बलवत्तराः ॥ ३९ ॥

abda-maasa-divaa-horaa'dhiishaastu balavattaraah | sha. bhau. bu. gu. shu. soraadyaa vriddhito balavattaraah || 39 ||

अंग्रेज़ी अर्थ

The lords of the year, the month, the day, and the hora are, in that order, increasingly strong [each stronger than the one before]. Saturn, Mars, Mercury, Jupiter, Venus, the Moon, and [the Sun] -- in this order (abbreviated in the text as "Sha. Bhau. Bu. Gu. Shu. Sora-adi") -- are increasingly strong.

हिन्दी अर्थ

वर्षेश, मासेश, दिनेश तथा होरेश — ये क्रमशः उत्तरोत्तर बली होते हैं। शनि, मंगल, बुध, गुरु, शुक्र, चन्द्र तथा [सूर्य] — इस क्रम में (मूल में "श. भौ. बु. गु. शु. सोरादि" संक्षेप में) — उत्तरोत्तर बली होते हैं।

स्रोत: BPHS Ch.3, verse 39, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.45 (main-text printed page 14), cross-verified at 1400dpi crop. Note: immediately following this verse, the page's Hindi commentary quotes two corroborating shlokas from Varahamihira's Brihat Jataka (introduced "varaahamihira ne bhii apane brihajjaatak men isii tarah kahaa hai"); those are a separate external text cited by the editor, not BPHS's own root verses, and are therefore not transcribed here as BPHS content, per this project's policy of transcribing only BPHS's own root verses. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्थूलान् जनयति त्वको दुर्भगान् सूर्यपुत्रकः । क्षीरोपेतांस्तथा चन्द्रः कटुकाद्यान् धरासुतः ॥ ४० ॥

sthuulaan janayati tvako durbhagaan suuryaputrakah | kshiiropetaamstathaa chandrah katukaadyaan dharaasutah || 40 ||

अंग्रेज़ी अर्थ

Saturn (son of the Sun) produces coarse, ill-shaped/misfortunate [trees]. The Moon likewise [produces] those bearing milk (latex-yielding); Mars (son of the Earth) [produces] pungent and similar [plants].

हिन्दी अर्थ

शनि (सूर्यपुत्र) स्थूल, कुरूप/अशुभ वृक्षों को उत्पन्न करता है। चन्द्रमा दुग्धयुक्त (दूधवाले) वृक्षों को, तथा मंगल (धरासुत) कटु आदि वनस्पतियों को उत्पन्न करता है।

स्रोत: BPHS Ch.3, verse 40, Kashi Sanskrit Series No.220, PDF p.45 (main-text printed page 14), cross-verified at 1400dpi crop. This opens the section "vrikshon ke utpaadak grah" (the planets that produce trees/plants). "Suryaputra" (Saturn) and "Dharasuta" (Mars) are this text's own recurring epithets. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सफलानफलाङ्गीवबुधौ [अनिश्चित संधि, टिप्पणी देखें], पुष्पतरून् कविः । नीरसान् सूर्यपुत्रश्च एवं ज्ञेयाः खगा द्विज ! ॥ ४१ ॥

saphalaanaphalaangiivabudhau [DISCLOSED, see note], pushpataruun kavih | niirasaan suuryaputrashcha evam jneyaah khagaa dvija ! || 41 ||

अंग्रेज़ी अर्थ

[DISCLOSED: the printed compound here, transcribed letter-for-letter as "saphalaanaphalaangiivabudhau," does not cleanly resolve into a standard Sanskrit reading -- the expected sense, confirmed by this page's own Hindi commentary ("guru saphal, budh nishphal (phalarahit) vrikshon ko ... utpanna karte hain"), is that Jupiter produces fruit-bearing trees and Mercury produces fruitless trees; that expected sense is given here rather than a forced literal parse of the garbled compound.] Venus (kavi) [produces] flowering trees. Saturn (son of the Sun) [produces] sapless/juiceless [plants]. Thus, O Brahmin, are the sky-going [planets, and their tree-products] to be known.

हिन्दी अर्थ

[स्पष्टीकरण: मुद्रित शब्द "सफलानफलाङ्गीवबुधौ" का शब्दशः पाठ किसी मानक संधि-नियम से स्पष्ट नहीं होता; अपेक्षित अर्थ — जिसकी पुष्टि इसी पृष्ठ की हिन्दी टीका ("गुरु सफल, बुध निष्फल वृक्षों को ... उत्पन्न करते हैं") से होती है — यह है कि गुरु फलदार वृक्षों को तथा बुध निष्फल वृक्षों को उत्पन्न करता है।] शुक्र (कवि) पुष्प वृक्षों को उत्पन्न करता है। शनि (सूर्यपुत्र) नीरस (रसहीन) वनस्पतियों को उत्पन्न करता है। इस प्रकार, हे द्विज! आकाशचारी ग्रहों को जानना चाहिए।

स्रोत: BPHS Ch.3, verse 41, Kashi Sanskrit Series No.220, PDF p.45 (main-text printed page 14), cross-verified at 2200dpi crop (bphs-ch3-v41word2.png). Genuine print/compound ambiguity disclosed above rather than silently normalized; the doctrinal sense is independently confirmed by the page's own Hindi commentary, briefly paraphrased/quoted only to the extent needed to support this disclosure, per copyright policy. This closes the tree-producing-planets section. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राहुश्चाण्डालजातिश्च केतुर्जात्यन्तरस्तथा । शिखिस्वभानुमन्दानां वल्मीकं स्थानमुच्यते ॥ ४२ ॥

raahushchaandaalajaatishcha keturjaatyantarastathaa | shikhisvabhaanumandaanaam valmiikam sthaanamuchyate || 42 ||

अंग्रेज़ी अर्थ

Rahu is of Chandala caste, and Ketu is likewise of a different (other) caste. The anthill (valmika) is said to be the abode of Ketu (Shikhi), Rahu (Svabhanu), and Saturn (Manda).

हिन्दी अर्थ

राहु चाण्डाल जाति का है, तथा केतु भी एक भिन्न (अन्य) जाति का है। केतु (शिखी), राहु (स्वभानु) तथा शनि (मन्द) का स्थान वल्मीक (बाँबी) कहा गया है।

स्रोत: BPHS Ch.3, verse 42, Kashi Sanskrit Series No.220, PDF p.45 (main-text printed page 14), cross-verified at 1400dpi crop. This opens the section "suuryaadigrahon ke jaati-vastraadi varnan" (the caste, garments, etc. of the planets from the Sun onward). "Shikhi" (Ketu) and "Svabhanu" (Rahu) are this text's own recurring epithets. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चित्रकन्था फणीन्द्रस्य, केतोश्छिद्रयुतो द्विज ! । सीसं राहोर्नीलमणिः केतोर्ज्ञेयो द्विजोत्तम ! ॥ ४३ ॥

chitrakanthaa phaniindrasya, ketoshchhidrayuto dvija ! | siisam raahornilamanih ketorjneyo dvijottama ! || 43 ||

अंग्रेज़ी अर्थ

The garment of the serpent-lord [Rahu] is a variegated/patched rag; that of Ketu, O Brahmin, is full of holes. Lead is to be known as Rahu's [gem/metal], and the blue gem (nilamani) as Ketu's, O best of Brahmins.

हिन्दी अर्थ

फणीन्द्र (राहु) का वस्त्र चित्र-कंथा (चितकबरी गुदड़ी) है; केतु का वस्त्र, हे द्विज! छिद्रयुक्त है। सीसा राहु का तथा नीलमणि केतु का [रत्न/धातु] जानना चाहिए, हे द्विजोत्तम!

स्रोत: BPHS Ch.3, verse 43, Kashi Sanskrit Series No.220, PDF p.45 (main-text printed page 14), cross-verified at 1400dpi crop. "Phanindra" (lord of serpents) is this text's own epithet for Rahu. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गुरोः पीताम्बरं विप्र ! भृगोः क्षौमं तथैव च । रक्तक्षौमं भास्करस्य, इन्दोः क्षौमं सितं द्विज ! ॥ ४४ ॥

guroh piitaambaram vipra ! bhrigoh kshaumam tathaiva cha | raktakshaumam bhaaskarasya, indoh kshaumam sitam dvija ! || 44 ||

अंग्रेज़ी अर्थ

Jupiter's garment is yellow, O Brahmin; and likewise Venus's (Bhrigu's) is silk (kshauma). The Sun's (Bhaskara's) is red silk; the Moon's (Indu's) is white silk, O Brahmin.

हिन्दी अर्थ

गुरु का वस्त्र पीला है, हे विप्र! तथा शुक्र (भृगु) का वस्त्र क्षौम (रेशमी) है। सूर्य (भास्कर) का वस्त्र रक्त क्षौम (लाल रेशमी) है; चन्द्रमा (इन्दु) का वस्त्र श्वेत क्षौम है, हे द्विज!

स्रोत: BPHS Ch.3, verse 44, Kashi Sanskrit Series No.220, PDF p.45 (main-text printed page 14), cross-verified at 1400dpi crop (bphs-ch3-v44line2b.png for the second line). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

बुधस्य त्वसितक्षौमं रक्तं तद्वत् कुजस्य च । वस्त्रं चित्रं शनेर्विप्र ! पट्टवल्कं तथैव च ॥ ४५ ॥

budhasya tvasitakshaumam raktam tadvat kujasya cha | vastram chitram shanervipra ! pattavalkam tathaiva cha || 45 ||

अंग्रेज़ी अर्थ

Mercury's [garment] is indeed dark-blue silk; likewise Mars's is red. Saturn's garment, O Brahmin, is variegated -- a coarse bark-cloth (patta-valka) as well.

हिन्दी अर्थ

बुध का वस्त्र असित (गहरे नीले रंग का) क्षौम है; उसी प्रकार मंगल का वस्त्र रक्त (लाल) है। शनि का वस्त्र, हे विप्र! चित्र-विचित्र — पट्टवल्क (मोटे वृक्ष-छाल का वस्त्र) भी है।

स्रोत: BPHS Ch.3, verse 45, Kashi Sanskrit Series No.220, PDF p.45 (main-text printed page 14), cross-verified at 1400dpi crop. This concludes the garment-color section for all planets. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भृगोच्छ्रितुवसन्तश्च [अनिश्चित संधि, टिप्पणी देखें] कुजभान्वाश्च ग्रैष्मकः । चन्द्रस्य वर्षा विज्ञेया शरच्चैव तथा विदः [DISCLOSED, see note] ॥ ४६ ॥

bhrigocchritu-vasantashcha [DISCLOSED, see note] kujabhaanvaashcha graishmakah | chandrasya varshaa vijneyaa sharachchaiva tathaa vidah [DISCLOSED, see note] || 46 ||

अंग्रेज़ी अर्थ

Bhrigu's [Venus's season] is [DISCLOSED: the compound opening this line is compressed in the print and not confidently parsed letter-for-letter, but the sense -- "Venus's season is spring" -- is clear from context and the commentary] Vasanta (spring); and Grīṣma (summer) belongs to Mars and the Sun. The Moon's [season] is to be known as Varṣā (the monsoon); and Śarad (autumn), likewise, [DISCLOSED: the printed word is "vidah," which does not match any Mercury-epithet used elsewhere in this text; the page's own Hindi commentary states plainly that autumn belongs to Mercury ("budha"), so "vidah" is very likely a compressed or misprinted form intending that name, but it is transcribed here exactly as printed rather than silently corrected] belongs to [Mercury?].

हिन्दी अर्थ

भृगु [शुक्र] का ऋतु वसन्त है [स्पष्टीकरण: पंक्ति का आरम्भिक संधि-पद मुद्रण में संकुचित होने से अक्षरशः स्पष्ट नहीं, किन्तु प्रसंग व टीका से अर्थ निश्चित है]; तथा ग्रीष्म मंगल और सूर्य का है। चन्द्रमा का [ऋतु] वर्षा जानना चाहिए; तथा शरद् ऋतु उसी प्रकार "विदः" [स्पष्टीकरण: मुद्रित शब्द "विदः" है, जो इस ग्रन्थ में अन्यत्र प्रयुक्त बुध के किसी भी नाम से मेल नहीं खाता; पृष्ठ की हिन्दी टीका स्पष्ट रूप से शरद् ऋतु को बुध का बताती है, अतः "विदः" सम्भवतः संकुचित या मुद्रण-त्रुटि है, किन्तु मूल पाठ को बिना सुधारे यहाँ ज्यों-का-त्यों दिया गया है] का है।

स्रोत: BPHS Ch.3, verse 46, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.46 (main-text printed page 15), cross-verified at 1400/2200dpi crops (bphs-ch3-v46.png, bphs-ch3-v46line1.png, bphs-ch3-v46line2.png). Discrepancy disclosed: the printed "vidah" for autumn's lord does not match this text's usual Mercury epithets; the page's own Hindi commentary ("varsha chandra ka, sharat budh ka") confirms the intended doctrine is Mercury, but the root text is transcribed exactly as printed per zero-fabrication policy. English/Hindi meanings by Vedic Hora -- for review. UPDATE: verse 3.53 (same chapter, page 16) independently and unambiguously uses "vidah" a second time, there naming Mercury's exaltation in Virgo -- confirmed by that page's own Hindi commentary. This corroborates that "vidah" is a genuine (if otherwise-unattested-in-summaries) epithet this text uses for Mercury, strengthening confidence in the reading here, though it remains an unusual epithet not glossed elsewhere and is left as printed rather than silently replaced with "Budha".

संस्कृत

हेमन्तोऽपि गुरोर्ज्ञेयः शनैस्तु शिशिरो द्विज ! । अष्टौ मासाश्च स्वर्भानोः केतोर्मासद्वयं द्विज ! ॥ ४७ ॥

hemanto'pi guror jneyah shanaistu shishiro dvija ! | ashtau maasaashcha svarbhaanoh ketor maasadvayam dvija ! || 47 ||

अंग्रेज़ी अर्थ

Hemanta (early winter) too is to be known as Jupiter's [season]; and Śiśira (late winter/the cool season), O Brahmin, belongs to Saturn. Eight months belong to Svarbhānu [Rāhu], and two months to Ketu, O Brahmin.

हिन्दी अर्थ

हेमन्त भी गुरु का जानना चाहिए; तथा शिशिर, हे द्विज!, शनि का है। स्वर्भानु [राहु] के आठ महीने हैं, तथा केतु के दो महीने, हे द्विज!।

स्रोत: BPHS Ch.3, verse 47, Kashi Sanskrit Series No.220, PDF p.46 (main-text printed page 15), cross-verified at 1400dpi crop (bphs-ch3-v46.png, which captured both verses 46 and 47). This completes the six-season (ritu) allocation across the seven classical planets, plus Rahu/Ketu's month-based allocation; independently corroborated by the page's own Hindi commentary, which states the full correspondence explicitly (vasanta=Shukra, grishma=Mangal-Surya, varsha=Chandra, sharad=Budh, hemanta=Guru, shishira=Shani, Rahu=8 months, Ketu=2 months) -- that commentary prose itself is not reproduced here, per copyright policy, but is cited as corroborating evidence for the translation above. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राह्वारपङ्कुचन्द्राश्च [अनिश्चित संधि, टिप्पणी देखें] विज्ञेया धातुखेचराः । मूलग्रहौ सूर्यशुक्रौ अपरे जीवसंज्ञकाः ॥ ४८ ॥

raahvaarapankuchandraashcha [DISCLOSED, see note] vijneyaa dhaatukhecharaah | muulagrahau suuryashukrau apare jiivasanjnakaah || 48 ||

अंग्रेज़ी अर्थ

Rahu, [DISCLOSED: the printed compound reads "...aara-panku-chandraah," evidently intending Mars and Saturn as the remaining two members of this group -- see note below] and the Moon are to be known as the dhātu-khecharāḥ (the mineral-ruling planets). The Sun and Venus are the two mūla-grahau (root/plant-ruling planets); the others [Mercury, Jupiter, and Ketu] are called jīva-saṃjñakāḥ (organic/living-being-ruling planets).

हिन्दी अर्थ

राहु, [स्पष्टीकरण: मुद्रित संधि-पद "...आरपङ्कुचन्द्राश्च" में स्पष्टतः मंगल तथा शनि इस समूह के शेष दो सदस्य अभिप्रेत हैं — टिप्पणी देखें] तथा चन्द्रमा धातु-खेचर (धातुओं के स्वामी ग्रह) जानने चाहिए। सूर्य और शुक्र दोनों मूलग्रह (वनस्पति/मूल के स्वामी) हैं; शेष [बुध, गुरु, केतु] जीवसंज्ञक (जीवों के स्वामी) कहलाते हैं।

स्रोत: BPHS Ch.3, verse 48, Kashi Sanskrit Series No.220, PDF p.46 (main-text printed page 15), cross-verified at 1400/2200dpi crops (bphs-ch3-v48.png, bphs-ch3-v48line1.png, bphs-ch3-v48line1b.png, bphs-ch3-v48line1c.png). Discrepancy disclosed: the compound's middle syllables, printed as "...ara-panku...", are expected on doctrinal and grammatical grounds to name Mars and Saturn (the page's own Hindi commentary lists the four dhatu-lords explicitly as "Rahu, Mangal, Shani, Chandrama"), but "panku" does not match any Saturn epithet used elsewhere in this text (not "Manda", "Shauri", or "Suryaputra"), so it is transcribed exactly as printed rather than emended. The commentary's own listing (not reproduced verbatim here, per copyright policy) independently confirms the four-way dhatu/mula/jiva structure. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ग्रहेषु मन्दो वृद्धोऽस्ति आयुर्वृद्धिप्रदायकः । नैसर्गिकं बहुसमा ददाति द्विजसत्तम ! ॥ ४९ ॥

graheshu mando vriddho'sti aayurvriddhipradaayakah | naisargikam bahusamaa dadaati dvijasattama ! || 49 ||

अंग्रेज़ी अर्थ

Among the planets, Saturn (Manda) is the elder (vṛddha), and is a bestower of increase of longevity. By its natural [influence], it gives [longevity] for many years, O best of Brahmins.

हिन्दी अर्थ

ग्रहों में शनि (मन्द) वृद्ध है, तथा आयु की वृद्धि करने वाला है। अपने नैसर्गिक स्वभाव से यह अनेक वर्षों तक [आयु] प्रदान करता है, हे द्विजसत्तम!

स्रोत: BPHS Ch.3, verse 49, Kashi Sanskrit Series No.220, PDF p.46 (main-text printed page 15), cross-verified at 1400dpi crop (bphs-ch3-v48.png captured line 1, bphs-ch3-v49.png captured line 2). Independently corroborated by the page's own Hindi commentary stating the same doctrine (Saturn as elder, a natural giver of longevity increase for many years) -- that commentary prose is not reproduced here, per copyright policy. This closes the dhatu/mula/jiva and elder-planet section; the exaltation/debilitation section begins at verse 50 under the heading "grahon ke uchcha-nicha sthaan" (exaltation and debilitation places of the planets). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अजो वृषो मृगश्चैव कन्या कर्कः झषस्तुला । सूर्यादीनां क्रमादेते गदितास्तूच्चराशयः ॥ ५० ॥

ajo vrisho mrigashchaiva kanyaa karkah jhashastulaa | suuryaadiinaam kramaadete gaditaastuuchcharaashayah || 50 ||

अंग्रेज़ी अर्थ

Aja (Aries), Vṛṣa (Taurus), Mṛga (Capricorn), Kanyā (Virgo), Karka (Cancer), Jhaṣa (Pisces), [and] Tulā (Libra) -- these, in order, are declared to be the exaltation-signs of the Sun and so forth [i.e. Sun=Aries, Moon=Taurus, Mars=Capricorn, Mercury=Virgo, Jupiter=Cancer, Venus=Pisces, Saturn=Libra].

हिन्दी अर्थ

अज (मेष), वृष (वृषभ), मृग (मकर), कन्या, कर्क, झष (मीन), तथा तुला — ये क्रमशः सूर्यादि ग्रहों की उच्चराशियाँ कही गई हैं [अर्थात् सूर्य=मेष, चन्द्र=वृषभ, मंगल=मकर, बुध=कन्या, गुरु=कर्क, शुक्र=मीन, शनि=तुला]।

स्रोत: BPHS Ch.3, verse 50, Kashi Sanskrit Series No.220, PDF p.46 (main-text printed page 15), cross-verified at 1400dpi crops (bphs-ch3-v49.png captured line 1, bphs-ch3-v50.png captured line 2). Independently corroborated by the page's own printed reference table "spashtaartha chakra" (exact-value wheel), which gives numeric sign-index/degree pairs for each planet's exaltation point matching this verse and the standard doctrine exactly. Also corroborated by the page's own Hindi commentary restating the same seven exaltation signs in the same order (not reproduced verbatim here, per copyright policy). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दशाम्भिमधुयुक्तिथ्यक्षनक्षत्रनखाः [अनिश्चित शब्द-संख्या संधि, टिप्पणी देखें] क्रमाद् । भागाः, समसमं तेभ्यो नीचं तैरेव भागकैः ॥ ५१ ॥

dashaambhimadhuyuktithyakshanakshatranakhaah [DISCLOSED, see note] kramaad | bhaagaah, samasamam tebhyo niicham tairaiva bhaagakaih || 51 ||

अंग्रेज़ी अर्थ

[DISCLOSED: this line is a bhūta-saṅkhyā (word-numeral) compound, where each word conventionally stands for a digit; it is genuinely difficult to parse letter-by-word with confidence in this scan, and is transcribed here exactly as printed rather than reconstructed -- see note] ...are the degrees (bhāgāḥ), in order [i.e. the exact degree of exaltation for each of the seven planets named in verse 50]. From those same [exaltation signs], counted equally to the seventh [sign], the debilitation (nīcha) [of each planet occurs] at those very same degrees.

हिन्दी अर्थ

[स्पष्टीकरण: यह पंक्ति भूत-संख्या (शब्द-अंक) पद्धति में है, जहाँ प्रत्येक शब्द परम्परागत रूप से एक अंक का सूचक होता है; इस स्कैन में इसे अक्षरशः, शब्द-दर-शब्द, विश्वासपूर्वक पढ़ पाना कठिन है, अतः इसे बिना पुनर्निर्माण किए ज्यों-का-त्यों दिया गया है — टिप्पणी देखें] ...अंश (डिग्री) हैं, क्रमशः [अर्थात् श्लोक ५० में वर्णित सातों ग्रहों की यथाक्रम उच्च-अंश मात्रा]। उन्हीं [उच्चराशियों] से ठीक सातवीं राशि में, उन्हीं अंशों पर, [प्रत्येक ग्रह की] नीच राशि होती है।

स्रोत: BPHS Ch.3, verse 51, Kashi Sanskrit Series No.220, PDF p.46 (main-text printed page 15), cross-verified at 1400/2200dpi crops (bphs-ch3-v51.png, bphs-ch3-v50line2.png). The bhutasankhya word-numeral compound in line 1 is disclosed as not confidently decoded word-by-word from this scan. However, the resulting degree values are independently and strongly corroborated by two separate sources on the same page: (1) the page's own Hindi commentary, which states plainly "in these signs, at 10, 3, 28, 15, 5, 27, 20 degrees respectively, the above planets have their exaltation point; from the exaltation sign, in the 7th sign, at those same degrees, the planets have their debilitation point"; and (2) a printed numeric reference table ("spashtaartha chakra") on the same page giving exact sign-index/degree pairs for each planet's exaltation (Sun=idx0/10deg, Moon=idx1/3deg, Mars=idx9/28deg, Mercury=idx5/15deg, Jupiter=idx3/5deg, Venus=idx11/27deg, Saturn=idx6/20deg) matching the standard, well-known doctrine exactly. These are cited as corroborating evidence for the degree values; the commentary prose and table are not reproduced verbatim here, per copyright policy -- only this verse's own root text is transcribed above. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विंशत्यंशा रवेः सिंहे त्रिकोणमपरे गृहम् । इन्दोर्वृषेऽग्निभागास्तु तुङ्गमन्ये त्रिकोणकम् ॥ ५२ ॥

vimshatyamshaa raveh simhe trikonamapare griham | indorvrishe'gnibhaagaastu tungamanye trikonakam || 52 ||

अंग्रेज़ी अर्थ

Twenty degrees of the Sun in Leo (Simha) are [its] moola-trikona; the remaining [ten degrees are its] own house. Of the Moon, in Taurus (Vrisha), the agni-bhaga [i.e. up to the third degree, "agni"/fire being the word-numeral for three] is [its] exaltation (tunga); the other [remaining twenty-seven degrees are its] moola-trikona.

हिन्दी अर्थ

सिंह राशि में सूर्य के बीस अंश मूलत्रिकोण हैं; शेष [दश अंश] उनका स्वगृह है। चन्द्रमा का, वृष राशि में, अग्निभाग [अर्थात् तीसरे अंश तक, "अग्नि" शब्द-संख्या में तीन का सूचक] उच्च (तुंग) है; शेष [सत्ताईस अंश] मूलत्रिकोण है।

स्रोत: BPHS Ch.3, verse 52, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.47 (main-text printed page 16), read from 400dpi full-page render (bphs-ch1-p47.png), text large and clear, no zoom crop needed. Opens the moola-trikona (root-triangle degree ranges) section following the exaltation/debilitation section (verses 50-51). Independently corroborated by the page's own Hindi commentary and by the numeric table on the preceding page (verse 51's source note). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मेषे कुजस्य सूर्यांशात्त्रिकोणमपरे गृहम् । तिथ्यंशैः कन्यकाराशौ विदस्तुङ्गं ततः परे ॥ ५३ ॥

meshe kujasya suuryaamshaattrikonamapare griham | tithyamshaih kanyakaaraashau vidastungam tatah pare || 53 ||

अंग्रेज़ी अर्थ

In Aries, up to the sūrya-aṃśa [i.e. the twelfth degree, "sūrya"/Sun being the word-numeral for twelve, referring to the twelve Ādityas] is Mars's moola-trikona; the remainder [is its] own house. By the tithi-aṃśa [i.e. up to the fifteenth degree, "tithi" being the word-numeral for fifteen lunar days] in Virgo (Kanyā) is Vidaḥ's [Mercury's] exaltation; beyond that [follows the moola-trikona].

हिन्दी अर्थ

मेष राशि में सूर्यांश [अर्थात् बारहवें अंश तक, "सूर्य" शब्द-संख्या में बारह आदित्यों का सूचक] तक मंगल का मूलत्रिकोण है; शेष उनका स्वगृह है। तिथ्यंश [अर्थात् पन्द्रहवें अंश तक, "तिथि" पन्द्रह तिथियों की संख्या का सूचक] तक कन्या राशि में विदः [बुध] का उच्च है; उसके आगे [मूलत्रिकोण है]।

स्रोत: BPHS Ch.3, verse 53, Kashi Sanskrit Series No.220, PDF p.47 (main-text printed page 16), read from 400dpi full-page render, text large and clear. NOTE: this verse independently and unambiguously uses "vidah" as a name for Mercury (confirmed by the page's own Hindi commentary describing this same Virgo passage as "kanya raashi mein 15 anshatak budh ka uchcha"). This retroactively corroborates verse 3.46's disclosed reading of "vidah" for autumn's planetary lord -- see the updated note on verse 3.46. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पञ्चांशकात्त्रिकोणाख्यास्तदग्रे तद्गृहं मतम् । गुरोर्धनुषि दिग्भागैस्त्रिकोणं तत्परं गृहम् ॥ ५४ ॥

panchaamshakaattrikonaakhyaastadagre tadgriham matam | guror dhanushi digbhaagaistrikonam tatparam griham || 54 ||

अंग्रेज़ी अर्थ

The next five degrees [in Virgo, i.e. degrees 15 to 20] are called [Mercury's] moola-trikona; beyond that, that [remainder, degrees 20 to 30,] is deemed its own house. Of Jupiter, in Sagittarius (Dhanu), by the dig-bhāga [i.e. up to the tenth degree, "dik"/direction being the word-numeral for the ten directions] is [its] moola-trikona; beyond that [is its] own house.

हिन्दी अर्थ

[कन्या राशि में] अगले पाँच अंश [अर्थात् १५ से २० तक] [बुध का] मूलत्रिकोण कहलाते हैं; उसके आगे वह [शेष, २० से ३० तक] उनका स्वगृह माना गया है। धनु राशि में गुरु का दिग्भाग [अर्थात् दस दिशाओं की संख्या-सूचक शब्द से दशम अंश तक] मूलत्रिकोण है; उसके आगे स्वगृह है।

स्रोत: BPHS Ch.3, verse 54, Kashi Sanskrit Series No.220, PDF p.47 (main-text printed page 16), read from 400dpi full-page render, text large and clear. Independently corroborated by the page's own Hindi commentary ("dhan mein guru ka dash ansh tak moolatrikona shesh unka apna ghar hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तुलार्धं तु त्रिकोणं स्याद् भृगोर्धं परं गृहम् । विंशत्यंशैर्घटे शौरेस्त्रिकोणं सद्य शेषकैः ॥ ५५ ॥

tulaardham tu trikonam syaad bhrigordham param griham | vimshatyamshairghate shaurestrikonam sadya sheshakaih || 55 ||

अंग्रेज़ी अर्थ

Half of Libra (Tulā) [i.e. degrees 0 to 15] is Venus's (Bhṛgu's) moola-trikona; the other half [degrees 15 to 30] is [its] own house. By twenty degrees, in Aquarius (Ghaṭa), is Saturn's (Śauri's) moola-trikona; [DISCLOSED: the printed word here, "sadya," does not cleanly complete the expected sense "the remainder [ten degrees, is its own house]" -- transcribed as printed] the remaining [degrees, presumably its own house].

हिन्दी अर्थ

तुला राशि का आधा भाग [अर्थात् ० से १५ अंश तक] शुक्र (भृगु) का मूलत्रिकोण है; शेष आधा भाग [१५ से ३० तक] उनका स्वगृह है। कुम्भ राशि में बीस अंश तक शनि (शौरि) का मूलत्रिकोण है; [स्पष्टीकरण: मुद्रित शब्द "सद्य" अपेक्षित अर्थ "शेष दश अंश स्वगृह है" से पूर्णतः स्पष्ट रूप से मेल नहीं खाता, अतः ज्यों-का-त्यों दिया गया है] शेष अंश [सम्भवतः स्वगृह]।

स्रोत: BPHS Ch.3, verse 55, Kashi Sanskrit Series No.220, PDF p.47 (main-text printed page 16), read from 400dpi full-page render, text large and clear. Closes the moola-trikona section for all seven classical planets (verses 52-55). Independently corroborated in overall doctrine by the page's own Hindi commentary and by a full numeric table on the same page (giving moola-trikona, own-house, and exaltation degree ranges for all seven planets), though the commentary/table prose is not reproduced here per copyright policy. "Sadya" in the second line does not parse cleanly against the expected sense and is disclosed rather than emended. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रवेः समो ज्ञः सितसूर्यपुत्रा वरी परे ते सुहृदो भवेयुः । चन्द्रस्य नारी रविचन्द्रपुत्रौ मित्रे समाः शेषनभश्चराः स्युः ॥ ५६ ॥

raveh samo jnah sitasuuryaputraa varii pare te suhrido bhaveyuh | chandrasya naarii ravichandraputrau mitre samaah sheshanabhashcharaah syuh || 56 ||

अंग्रेज़ी अर्थ

To the Sun, Mercury (jña) is neutral (sama); Venus (sita) and Saturn (sūryaputra) are enemies (vairī); the rest [Moon, Mars, and Jupiter] would be [its] friends (suhṛd). Of the Moon, [DISCLOSED: the printed "nārī" most plausibly intends "na ari" ("has no enemy") -- transcribed as printed rather than emended] [DISCLOSED: "ravichandraputrau" most plausibly intends "the Sun and Mercury" (ravi-jñau), matching the standard doctrine that the Sun and Mercury are the Moon's friends -- but the compound as printed does not parse cleanly, so it is transcribed as printed rather than emended] are friends (mitre); the remaining sky-farers [Mars, Jupiter, Venus, and Saturn] would be neutral (samāḥ).

हिन्दी अर्थ

सूर्य के प्रति बुध (ज्ञ) सम (तटस्थ) है; शुक्र (सित) और शनि (सूर्यपुत्र) शत्रु (वैरी) हैं; शेष [चन्द्र, मंगल, गुरु] मित्र होंगे। चन्द्रमा के [स्पष्टीकरण: मुद्रित "नारी" सम्भवतः "न अरि" ("जिसका कोई शत्रु नहीं") का सूचक है, किन्तु ज्यों-का-त्यों दिया गया है] [स्पष्टीकरण: "रविचन्द्रपुत्रौ" सम्भवतः "रवि-ज्ञौ" (सूर्य और बुध) का सूचक है, जो मानक सिद्धान्त से मेल खाता है, किन्तु मुद्रित संधि-पद स्पष्ट रूप से नहीं बैठता, अतः ज्यों-का-त्यों दिया गया है] मित्र हैं; शेष ग्रह [मंगल, गुरु, शुक्र, शनि] सम (तटस्थ) होंगे।

स्रोत: BPHS Ch.3, verse 56, Kashi Sanskrit Series No.220, PDF p.47 (main-text printed page 16), read from 400dpi full-page render and confirmed at a 2000dpi tight crop (bphs-ch3-v56b.png). Opens the new section on the planets' natural (naisargika) mutual friendship/enmity, following the moola-trikona section (verses 52-55), under the heading "grahon ka vaisargika mitraamitra". The verse's own doctrine for the Sun's relations (Mercury=neutral, Venus & Saturn=enemies, Moon/Mars/Jupiter=friends) matches the well-known standard naisargika-maitri system exactly; the second line's account of the Moon's relations (which in the standard system has no enemies and counts the Sun and Mercury as its only friends) is disclosed as containing two words ("naarii", "ravichandraputrau") that do not parse cleanly against the otherwise-matching expected doctrine, and are transcribed exactly as printed rather than emended to fit that doctrine. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

समौ सितार्की शशिजश्च शत्रुमित्राणि शेषाः पृथिवीसुतस्य । शत्रुः शशी सूर्यसितौ च मित्रे समाः परे स्युः शशिनन्दनस्य ॥ ५७ ॥

samau sitaarkii shashijashcha shatrumitraani sheshaah prithiviisutasya | shatruh shashii suuryasitau cha mitre samaah pare syuh shashinandanasya || 57 ||

अंग्रेज़ी अर्थ

Venus (sitā) and Saturn (arkī) are neutral (sama) to Pṛthvī-suta (Mars); Śaśija (Mercury) [is its enemy] -- these are the remaining friend/enemy [relations] of Mars [beyond the friends already named]. The Moon (Śaśī) is an enemy; the Sun and Venus are friends; the rest would be neutral -- to Śaśinandana (Mercury, "son of the Moon").

हिन्दी अर्थ

शुक्र (सिता) और शनि (अर्की) मंगल (पृथ्वीसुत) के प्रति सम (तटस्थ) हैं; शशिज (बुध) [उसका शत्रु है] — ये मंगल के शेष मित्र/शत्रु सम्बन्ध हैं। चन्द्रमा (शशी) शत्रु है; सूर्य और शुक्र मित्र हैं; शेष सम होंगे — बुध (शशिनन्दन, "चन्द्रमा का पुत्र") के प्रति।

स्रोत: BPHS Ch.3, verse 57, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.48 (main-text printed page 17), read from 400dpi full-page render, text large and clear, no zoom crop needed. Independently confirmed by the page's own Hindi commentary ("mangal ke shukra, shani sam, budh shatru, anya (surya, chandra, guru) mitra hain; budh ke chandrama shatru, surya-shukra mitra, shesh sam hain") and by a full numeric friendship table on the same page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गुरोर्ज्ञशुक्रौ रिपुसंज्ञकौ तु शनिः समोऽन्ये सुहृदो भवन्ति । शुक्रस्य मित्रे बुधसूर्यपुत्रौ समौ कुजार्यावितरावरी तौ ॥ ५८ ॥

guror jnashukrau ripusanjnakau tu shanih samo'nye suhrido bhavanti | shukrasya mitre budhasuuryaputrau samau kujaaryaavitaraavarii tau || 58 ||

अंग्रेज़ी अर्थ

Of Jupiter, Mercury and Venus are called enemies (ripu); Saturn is neutral; the others [Sun, Moon, Mars] become friends. Of Venus, Mercury and Saturn (sūryaputra) are friends; Mars and Ārya (Jupiter) are neutral; the other two [Sun and Moon] are enemies (arī).

हिन्दी अर्थ

गुरु के प्रति बुध और शुक्र शत्रु कहलाते हैं; शनि सम है; शेष [सूर्य, चन्द्र, मंगल] मित्र होते हैं। शुक्र के प्रति बुध और शनि (सूर्यपुत्र) मित्र हैं; मंगल और आर्य (गुरु) सम हैं; शेष दो [सूर्य, चन्द्र] शत्रु (अरी) हैं।

स्रोत: BPHS Ch.3, verse 58, Kashi Sanskrit Series No.220, PDF p.48 (main-text printed page 17), read from 400dpi full-page render, text large and clear. Independently confirmed by the page's own Hindi commentary ("guru ke budh, shukra shatru, shani sam, shesh (surya, chandra, mangal) mitra hain; shukra ke budh shani mitra, mangal, guru sam, anya (ravi, chandra) shatru hain"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शनेः समो वाक्पतिरिन्दुसूनुशुक्रौ च मित्रे रिपवः परेऽपि । ध्रुवं ग्रहाणां चतुराननेन शत्रुत्वमित्रत्वसमत्वमुक्तम् ॥ ५९ ॥

shaneh samo vaakpatirindusuunushukrau cha mitre ripavah pare'pi | dhruvam grahaanaam chaturaananena shatrutvamitratvasamatvamuktam || 59 ||

अंग्रेज़ी अर्थ

Of Saturn, Vākpati (Jupiter) is neutral; Indu-sūnu (Mercury, "son of the Moon") and Venus are friends; the remaining others [Sun, Moon, Mars] are also enemies. This fixed (dhruvam) enmity, friendship, and neutrality of the planets was declared by the four-faced one (Chaturānana, i.e. Brahmā) himself.

हिन्दी अर्थ

शनि के प्रति वाक्पति (गुरु) सम है; इन्दुसूनु (बुध, "चन्द्रमा का पुत्र") और शुक्र मित्र हैं; शेष अन्य [सूर्य, चन्द्र, मंगल] भी शत्रु हैं। ग्रहों का यह निश्चित शत्रुत्व, मित्रत्व तथा समत्व स्वयं चतुरानन (ब्रह्मा) द्वारा कहा गया है।

स्रोत: BPHS Ch.3, verse 59, Kashi Sanskrit Series No.220, PDF p.48 (main-text printed page 17), read from 400dpi full-page render, text large and clear. Closes the naisargika-maitri (natural friendship) section for all seven classical planets (verses 56-59), attributing the doctrine to Brahma; independently confirmed by the page's own Hindi commentary ("shani ke guru sam, budh-shukra mitra, surya-chandra-mangal shatru hain... graahon ka yah svaabhaavik mitraamitra-samatva brahmaa jii ne svayam batalaayaa hai") and by a full numeric friendship table on the same page. NOTE: immediately following this verse and its commentary, the page quotes a corroborating shloka attributed by name to "Satyacharya" (an external authority the commentator cites, introduced explicitly as "satyaachaarya ne kahaa hai"); per this project's policy of transcribing only BPHS's own root verses, that quoted shloka is not reproduced here as BPHS content. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दशायबन्धुसहजस्वान्त्यस्थास्ते परस्परम् । तत्काले सुहृदोऽन्यत्र संस्थिताः शत्रवः स्मृताः ॥ ६० ॥

dashaayabandhusahajasvaantyasthaaste parasparam | tatkaale suhrido'nyatra samsthitaah shatravah smritaah || 60 ||

अंग्रेज़ी अर्थ

[Planets] situated, relative to each other (parasparam), in the [houses named by the compound] daśa (10th), āya (11th), bandhu (4th), sahaja (3rd), sva, and antya (12th) [DISCLOSED: this compound is here read, per the page's own commentary, as naming the 10th, 11th, 4th, 3rd, 2nd, and 12th houses counted from each other -- i.e. the three houses immediately following and the three immediately preceding a planet's own position; the mapping of the individual words "sva" and "antya" to the 2nd and 12th houses specifically is inferred from the commentary's numeric restatement rather than being independently certain word-by-word] -- these, at that time (tatkāle), are remembered as friends (suhṛd); [planets] situated elsewhere are remembered as enemies (śatru).

हिन्दी अर्थ

परस्पर एक-दूसरे से दशम (१०), आय (११), बन्धु (४), सहज (३), स्व, तथा अन्त्य (१२) [स्पष्टीकरण: पृष्ठ की हिन्दी टीका के अनुसार यह संधि-पद क्रमशः १०, ११, ४, ३, २, तथा १२वें स्थान का सूचक माना गया है — किन्तु "स्व" व "अन्त्य" शब्दों का क्रमशः २रे व १२वें स्थान से यह शब्दशः सम्बन्ध टीका के अंकों से अनुमानित है, स्वतः पूर्णतः निश्चित नहीं] स्थानों में स्थित ग्रह उस समय मित्र माने जाते हैं; अन्यत्र स्थित ग्रह शत्रु माने जाते हैं।

स्रोत: BPHS Ch.3, verse 60, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.49 (main-text printed page 18), read from 400dpi full-page render, text large and clear. Opens the section on tatkalika (temporary, positional) friendship, following the naisargika (natural) friendship section (verses 56-59). The page's own Hindi commentary restates the rule numerically ("kisii grah ke apne sthaan se 10,11,4,3,2,12 sthaanon mein sthit grah taatkaalik mitra hote hain; shesh 1,5,6,7,8,9 sthaanon mein sthit grah unke shatru hote hain") and includes an illustrative example birth-chart diagram ("janmaanka chakra") with a worked numeric friendship table -- these are the editor's own illustrative apparatus, not part of BPHS's root verse text, and are cited here only as corroborating context, not transcribed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नैसर्गिके तथा तात्कालिके मित्रेऽधिमित्रकम् । समे मित्रे च मित्रं तूभयत्राधिरिपू रिपौ ॥ ६१ ॥

naisargike tathaa taatkaalike mitre'dhimitrakam | same mitre cha mitram tuubhayatraadhiripuu ripau || 61 ||

अंग्रेज़ी अर्थ

When [a planet is a] friend both in the natural (naisargika) and the temporary (tatkalika) [reckoning, the combined result is] adhi-mitra (a great/best friend). When [it is] neutral [in one reckoning] and a friend [in the other, the result is simply] mitra (a [plain] friend). When [it is] an enemy in both [reckonings, the result is] adhi-ripu (a great/bitter enemy).

हिन्दी अर्थ

जब कोई ग्रह नैसर्गिक तथा तात्कालिक दोनों में मित्र हो, [तो संयुक्त फल] अधिमित्र होता है। जब एक में सम और दूसरे में मित्र हो, [तो फल] मात्र मित्र होता है। जब दोनों में शत्रु हो, [तो फल] अधिशत्रु (घोर शत्रु) होता है।

स्रोत: BPHS Ch.3, verse 61, Kashi Sanskrit Series No.220, PDF p.49 (main-text printed page 18), read from 400dpi full-page render, text large and clear, under the heading "panchadhaa maitrii" (fivefold friendship). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

समे शत्रौ शत्रुरेव शत्रौ मित्रे समः स्मृतः । एवं विचार्य गुणकैः फलं वाच्यं यथोदितम् ॥ ६२ ॥

same shatrau shatrureva shatrau mitre samah smritah | evam vichaarya gunakaih phalam vaachyam yathoditam || 62 ||

अंग्रेज़ी अर्थ

When [a planet is] neutral [in one reckoning] and an enemy [in the other, the result is] an enemy (śatru) indeed. When [it is] an enemy [in one] and a friend [in the other, the result is] remembered as neutral (sama). Having thus determined [the fivefold friendship] by these combined factors (guṇakaiḥ), the result (phala) should be declared as stated [by the applicable rules].

हिन्दी अर्थ

जब एक में सम और दूसरे में शत्रु हो, [तो फल] शत्रु ही होता है। जब एक में शत्रु और दूसरे में मित्र हो, [तो फल] सम माना गया है। इस प्रकार इन संयुक्त कारकों से विचार कर फल यथोक्त रूप से कहना चाहिए।

स्रोत: BPHS Ch.3, verse 62, Kashi Sanskrit Series No.220, PDF p.49 (main-text printed page 18), read from 400dpi full-page render, text large and clear. Closes the panchadha-maitri (fivefold friendship: adhimitra, mitra, sama, shatru, adhishatru) section, verses 60-62, which combines the naisargika (verses 56-59) and tatkalika (verse 60) friendship systems. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वोच्चे शुभं बलं पूर्णं त्रिकोणे पादवर्जितम् । स्वर्क्षे दलं मित्रगेहे पादमात्रं प्रकीर्त्तितम् ॥ ६३ ॥

svochche shubham balam puurnam trikone paadavarjitam | svarkshe dalam mitragehe paadamaatram prakiirttitam || 63 ||

अंग्रेज़ी अर्थ

In its own exaltation (svochcha), [a planet's] auspicious strength (bala) is full (pūrṇa, i.e. a full unit). In its [moola-]trikoṇa, [the strength is] minus a quarter (pāda-varjita, i.e. three-quarters). In its own sign (svarkṣa), [it is] half (dala). In a friend's house (mitra-geha), a quarter (pāda-mātra) is declared.

हिन्दी अर्थ

अपनी उच्चराशि में ग्रह का शुभ बल पूर्ण (एक इकाई) होता है। मूलत्रिकोण में [बल] एक चतुर्थांश कम (अर्थात् तीन चौथाई) होता है। स्वराशि में आधा (दल) होता है। मित्र के गृह में एक चतुर्थांश (पाद-मात्र) कहा गया है।

स्रोत: BPHS Ch.3, verse 63, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.50 (main-text printed page 19), read from 400dpi full-page render, text large and clear. Opens the section on uchchadi-sthanabala (positional strength by exaltation/own-sign/friend's-sign etc.), following the panchadha-maitri (fivefold friendship) section (verses 60-62). Independently confirmed by the page's own Hindi commentary, which restates the same five-then-sixfold scale numerically (full, three-quarters, half, quarter, an eighth, zero) for exaltation/moolatrikona/own-house/friend's-house/neutral's-house/debilitation-combustion-enemy's-house respectively. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पादार्धं समभे प्रोक्तं वियोनीचास्तशत्रुभे । तद्वदेवाशुभं ब्रूयाद् व्यत्ययेन विचक्षणः ॥ ६४ ॥

paadaardham samabhe proktam viyoniichaastashatrubhe | tadvadevaashubham bruuyaad vyatyayena vichakshanah || 64 ||

अंग्रेज़ी अर्थ

An eighth (pādārdha, half of a quarter) is declared in a neutral's (sama) house; and [zero, i.e. no strength at all] in debilitation (vi-yoni [DISCLOSED: the printed compound is unusual, but the commentary confirms this means "nīcha", debilitation]), combustion (asta), and an enemy's house. Likewise, the wise one (vichakṣaṇa) should state the inauspicious (malefic) strength in reverse order (vyatyayena) [i.e. applying this same scale in the opposite sense for malefic results].

हिन्दी अर्थ

सम के घर में अष्टमांश (पादार्ध, अर्थात् चौथाई का आधा) कहा गया है; तथा नीच [स्पष्टीकरण: मुद्रित संधि-पद असामान्य है, किन्तु टीका इसे "नीच" ही बताती है], अस्त, तथा शत्रुगृह में [बल शून्य होता है]। इसी प्रकार अशुभ (पाप) बल को विचक्षण पुरुष व्यत्यय (उलटे क्रम) से कहे [अर्थात् इसी मात्रा को पाप ग्रहों के अशुभ फल हेतु विपरीत क्रम में लागू करे]।

स्रोत: BPHS Ch.3, verse 64, Kashi Sanskrit Series No.220, PDF p.50 (main-text printed page 19), read from 400dpi full-page render, text large and clear. Closes the uchchadi-sthanabala section (verses 63-64). Independently confirmed by the page's own Hindi commentary ("sam ke ghar mein ashtamansh maatra, nicha, ast, evam shatrugriha mein shunya bal hota hai; isi tarah uchchaadi upayukt sthaanon mein vaiparitya se ashubhaprad bal bhi samajhana chahiye"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पञ्चाङ्गस्थो मिश्रमानकालः पङ्क्तिसमाह्वयः । सूर्योदयाद्यातकालः सावनेष्ट उदीरितः ॥ १ ॥

panchaangastho mishramaanakaalah panktisamaahvayah | suuryodayaad yaatakaalah saavaneshta udiiritah || 1 ||

अंग्रेज़ी अर्थ

The mixed-measure time (mishra-mana-kala) found in the pancha-anga (the five-limbed almanac/panchang) is called by the name 'pankti'. The time elapsed (yata-kala) from sunrise [to the desired moment] is declared [to be] the desired savana (solar-day-based) time.

हिन्दी अर्थ

पंचांग में स्थित मिश्रमान काल 'पंक्ति' नाम से कहा जाता है। सूर्योदय से (अभीष्ट क्षण तक) बीता हुआ काल (यातकाल) अभीष्ट सावन काल कहा गया है।

स्रोत: BPHS Ch.4, verse 1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.51 (main-text printed page 20), read from a 1000-3000dpi tight crop after the chapter's opening heading "atha grahadisadhanaa'dhyayah" and subheading "grahon ka taatkaalikiikaran" (temporization of the planets). DISCLOSED/RESOLVED: the second word's opening syllable was initially ambiguous between "pashcha" (श्चा) and "pancha" (ञ्चा) at first glance; a 3000dpi close zoom on the glyph shape, PLUS the page's own Hindi commentary independently using the identical spelling in "panchaangasthit mishramaan-kaal ko pankti kahate hain" (confirming the intended technical sense: the almanac-based mixed-measure time), together confirm the reading as "panchaanga-stha" (situated in the panchanga), not "pashchaanga" (which is not a standard term in this context). Opens a new technical section on computing an ishta-kala time-correction from panchang data -- distinct in register from Chapter 3's classificatory verses. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दिनाघमन्तरं यच्च तयोर्यातैष्यकं हि तत् । पङ्क्त्याधिक्ये यातसंज्ञमैष्यमिष्टेऽधिके स्मृतम् ॥ २ ॥

dinaaghamantaram yachcha tayoryaataishyakam hi tat | panktyaadhikye yaatasanjnamaishyamishte'dhike smritam || 2 ||

अंग्रेज़ी अर्थ

And whatever difference in days(-and-fractions) (dinadi-antara) exists between these two [the ishta-kala and the pankti-kala] -- that indeed is [called] the 'yataishyaka' (elapsed-or-yet-to-come figure). When the pankti[-kala] is the greater, it is remembered under the name 'yata' (elapsed); when the ishta[-kala] is the greater, [it is remembered as] 'aishya' (yet to come).

हिन्दी अर्थ

इन दोनों (इष्टकाल व पंक्तिकाल) का जो दिनादि अंतर है, वही 'यातैष्यक' कहलाता है। पंक्तिकाल के अधिक होने पर उसे 'यात' संज्ञा से, तथा इष्टकाल के अधिक होने पर 'ऐष्य' संज्ञा से स्मरण किया गया है।

स्रोत: BPHS Ch.4, verse 2, Kashi Sanskrit Series No.220, PDF p.51 (main-text printed page 20), read from clean 2000-3000dpi crops covering the full line in two halves, text clear and unambiguous. Independently confirmed by the page's own Hindi commentary, which restates the same rule in almost the same words: "donon kalon ke dinaadik antar ko yaatakaal ya aishyakaal kahate hain; ishtakaal se pankti-kaal yadi aage ho ... to pankti-kaal mein se ishtakaal ko ghataaven, dinaadik avashesh ko rinaatmak ya yaatasangyak samajhen; pankti-kaal se ishtakaal hi yadi aage ho ... to ishtakaal se hi pankti-kaal ko ghataakar dinaadik shesh ko dhanaatmak ya aishya samajhen." English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ऋणं धनं दिनाद्यं तद् गुणितं ग्रहभुक्तिभिः । खरसैर्विहृतं लब्धमंशाद्यं चालनं फलम् ॥ ३ ॥

rinam dhanam dinaadyam tad gunitam grahabhuktibhih | kharasairvihritam labdhamamshaadyam chaalanam phalam || 3 ||

अंग्रेज़ी अर्थ

That debit-or-credit (rina/dhana) day-fraction (dinadi), multiplied by the planet's [daily] motion (graha-bhukti), [and] divided by 'kharasa' [DISCLOSED: a bhuta-sankhya (word-numeral) compound; not confidently decoded word-by-word, but inferred -- consistent with the standard classical procedure of dividing a day into 60 ghatikas -- to denote sixty (60)] -- the degree-etc. (amshadi) quotient (labdha) so obtained is the correction (chalana) result (phala).

हिन्दी अर्थ

वह ऋण या धन दिनादि (घटी-पल का अंतर), ग्रह की दैनिक गति से गुणा करके, 'खरसैः' [स्पष्टीकरण: यह एक भूतसंख्या (शब्द-अंक) पद है, शब्दशः पूर्ण निश्चित नहीं, किंतु दिन के ६० घटी होने की मानक गणना-प्रणाली के अनुरूप साठ (६०) का सूचक अनुमानित] से भाग देने पर जो अंशादि लब्धि प्राप्त हो, वही चालन-फल कहलाता है।

स्रोत: BPHS Ch.4, verse 3, Kashi Sanskrit Series No.220, PDF p.51 (main-text printed page 20), read from clean 2000-3000dpi crops, text clear. The word "kharasaih" is a bhuta-sankhya (word-numeral) term of the same kind already encountered and disclosed in Ch.3 v.51 (agni/surya/tithi/dik/nakshatra/nakha degree-numerals) -- here its exact word-by-word derivation is not independently confirmed, but the surrounding Hindi commentary describes the identical division-by-60 procedure ("aanit rina-dhan ya yataishya dinaadik ko tattad-grahagati se gunaakar 60 se bhaag dene par jo anshaadik labdhi aave"), and division by 60 (the number of ghatikas in a day) is the standard step in this classical ishta-sphuta/chalana correction procedure, strongly corroborating the numeric value even though the word-numeral itself is left undecoded rather than silently asserted. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पङ्क्तिग्रहेषु संशोध्यं योज्यं च क्रमशस्तदा । तात्कालिकग्रहा वामं पाते वक्रखगेऽपि तत् ॥ ४ ॥

panktigraheshu samshodhyam yojyam cha kramashastadaa | taatkaalikagrahaa vaamam paate vakrakhage'pi tat || 4 ||

अंग्रेज़ी अर्थ

Then that [chalana correction] should respectively be subtracted from, or added to, the pankti-planets [the planetary positions as given by the almanac] -- [thus] the tatkalika (currently-corrected, temporized) planets [are obtained]. At a node (pata, i.e. Rahu/Ketu), and likewise for a retrograde planet (vakra-khaga), that [same procedure] is applied in reverse (vamam).

हिन्दी अर्थ

तब उस चालन को पंक्तिग्रहों में क्रमशः घटाना या जोड़ना चाहिए -- इस प्रकार तात्कालिक ग्रह प्राप्त होते हैं। पात (राहु-केतु) में तथा वक्री ग्रह में भी यही क्रिया उलटे क्रम (वाम) से करनी चाहिए।

स्रोत: BPHS Ch.4, verse 4, Kashi Sanskrit Series No.220, PDF p.51 (main-text printed page 20), read from a 1000dpi crop of the page's bottom strip, text clear and unambiguous. Closes the four-verse tatkalikikarana (temporization) procedure opened at v.1: pancha-anga time (v.1) -> yata/aishya difference (v.2) -> chalana correction figure (v.3) -> applying that correction, with sign reversed for nodes and retrograde planets (v.4). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सत्यंशैश्चीन्दुभागैर्भैश्चतुर्भिश्च युतो रविः ॥ ५ ॥

satyanshaishchiindubhaagairbhaishchaturbhishcha yuto ravih || 5 ||

अंग्रेज़ी अर्थ

The [true, spashta] Sun, joined by [a bhuta-sankhya (word-numeral) figure here DISCLOSED as not confidently decoded word-by-word, but firmly corroborated by the page's own following commentary, which explicitly restates the value] four signs (rashi), thirteen degrees (amsha), and twenty minutes (kala) -- [the result of this addition is what the next verse names Dhuma].

हिन्दी अर्थ

[स्पष्ट] सूर्य में [एक भूतसंख्या (शब्द-अंक) मान, जिसे शब्दशः पूर्ण निश्चय के साथ नहीं पढ़ा जा सका, किन्तु अगले श्लोक की टीका में स्पष्ट रूप से पुनः कहे गए मान से दृढ़तापूर्वक पुष्ट है:] चार राशि, तेरह अंश, और बीस कला जोड़ने पर [जो प्राप्त होता है, उसे अगला श्लोक 'धूम' नाम देता है]।

स्रोत: BPHS Ch.4, verse 5, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.52 (main-text printed page 21, final line) continuing onto PDF p.53 (printed page 22). Read via multiple 3000dpi crops after an initial mistargeted attempt landed on an unrelated worked numeric example; the final successful crop confirmed the printed text unambiguously as "satyamshaishchiindubhaagairbhaishchaturbhishcha yuto ravih". DISCLOSED: this is a bhuta-sankhya (word-numeral) verse of the same kind already flagged in Ch.3 v.51 and Ch.4 v.3 -- the individual words (satya/amsha/indu/bhaga/bhaih/chatur) are not independently decoded letter-by-word here, but the page's own detailed commentary immediately following verse 8 explicitly restates the numeric value in full: the Sun plus four signs (rashi), thirteen degrees, and twenty minutes gives Dhuma -- strongly corroborating the intended value even though the verse's own word-numeral derivation is left undecoded rather than silently asserted. This verse opens a new heading, "dhuumaadi apraakaash grahon kaa saadhan" (computation of the non-luminous planets beginning with Dhuma), distinct in subject from the preceding tatkalikikarana section (verses 1-4). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धूमो नाम महादोषः सर्वकर्मविनाशकः । धूमो मण्डलतः शुद्धो व्यतीपातोऽत्र दोषदः ॥ ६ ॥

dhuumo naama mahaadoshah sarvakarmavinaashakah | dhuumo mandalatah shuddho vyatiipaato'tra doshadah || 6 ||

अंग्रेज़ी अर्थ

[The figure so obtained,] named Dhuma ("smoke"), is a great affliction (maha-dosha) [that is] the destroyer of all undertakings (sarva-karma-vinashaka). Dhuma, cleared/rectified (shuddha) from (mandalatah) the [full] circle (mandala, i.e. subtracted from 360 degrees / twelve signs), [gives] Vyatipata -- here too an affliction-giver (doshada).

हिन्दी अर्थ

यह प्राप्त मान धूम नाम से जाना जाता है, जो एक महादोष है और समस्त कार्यों का नाशक है। धूम को मण्डल (३६०° अर्थात् बारह राशि) में से घटाकर शुद्ध करने पर व्यतीपात प्राप्त होता है -- यह भी यहाँ दोषकारक है।

स्रोत: BPHS Ch.4, verse 6, Kashi Sanskrit Series No.220, PDF p.53 (printed page 22), read from clean 3000dpi split crops covering the full two-line verse; text clear and unambiguous. Independently confirmed by the page's own detailed commentary immediately following verse 8, which explicitly restates "dhuuma ko 12 raashi (360 digree) mein se ghataane par vyatiipaat hotaa hai" (subtracting Dhuma from 12 signs/360 degrees gives Vyatipata). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सषड्भेदऽत्र व्यतीपाते परिवेषस्तु दोषकृत् । परिवेषश्च युतश्चक्रादिन्द्रचापश्च दोषदः ॥ ७ ॥

shashadbheda'tra vyatiipaate pariveshastu doshakrit | pariveshashcha yutashchakraadindrachaapashcha doshadah || 7 ||

अंग्रेज़ी अर्थ

Here, in that Vyatipata, together with a six-fold [i.e. six-sign, 180-degree] addition (sha-shad-bheda) [DISCLOSED: this is a terse, compressed construction; its precise arithmetic sense -- Vyatipata plus six signs -- is confirmed not by grammatical decomposition alone but by the page's own following commentary, which explicitly restates the identical numeric procedure], Parivesha indeed becomes the affliction-doer. And Parivesha, joined with [i.e. reckoned against] the circle (chakrat) [DISCLOSED: likewise a compressed phrase; the commentary explicitly confirms the operation performed here is subtracting Parivesha from the circle/360 degrees], [gives] Indrachapa, which is also affliction-giving.

हिन्दी अर्थ

यहाँ उस व्यतीपात में छह राशि (१८०°) जोड़ने पर [स्पष्टीकरण: यह संक्षिप्त पद है; इसका ठीक-ठीक गणितीय अर्थ -- व्यतीपात में छह राशि जोड़ना -- केवल शब्द-विच्छेद से नहीं, अपितु पृष्ठ की अपनी टीका के स्पष्ट पुनर्कथन से पुष्ट है] परिवेष दोषकारक होता है। तथा परिवेष को चक्र (मण्डल/३६०°) के सन्दर्भ में लेकर [स्पष्टीकरण: यह भी संक्षिप्त पद है; टीका स्पष्ट करती है कि यहाँ परिवेष को ३६०° में से घटाया जाता है] इन्द्रचाप प्राप्त होता है, जो भी दोषदायक है।

स्रोत: BPHS Ch.4, verse 7, Kashi Sanskrit Series No.220, PDF p.53 (printed page 22), read from clean 3000dpi split crops (left/right halves per line, plus one confirmatory tight zoom on "pariveshashcha yutashchakraat" to rule out a suspected but absent "vi-" (subtractive) prefix -- the printed text is confirmed as "yuta" not "viyuta"). DISCLOSED: the verse's own wording for both operations (Vyatipata+6 signs -> Parivesha; Parivesha vs. the circle -> Indrachapa) is compressed/elliptical rather than spelling out addition/subtraction explicitly; the exact arithmetic sense is not asserted from grammar alone but is strongly corroborated by the page's own detailed commentary immediately after verse 8, which explicitly restates: "vyatiipaat mein 6 raashi jodne par parivesh hotaa hai; parivesh ko 12 raashi mein se ghataane par indrachaap hotaa hai" (adding 6 signs to Vyatipata gives Parivesha; subtracting Parivesha from 12 signs gives Indrachapa). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

र्यंशोनात्यष्टिभागैश्च युतश्चापोऽशुभः शिखी । एकराशियुते केतौ सूर्यो राश्यादिको भवेत् ॥ ८ ॥

ryamshonaatyashtibhaagaishcha yutashchaapo'shubhah shikhii | ekaraashiyute ketau suuryo raashyaadiko bhavet || 8 ||

अंग्रेज़ी अर्थ

[DISCLOSED: the opening conjunct of this line is fully present on the page -- not a scan-edge gap, contrary to an earlier working guess -- but its exact letters are not confidently decodable at this print's resolution; it is transcribed here as best-effort "rya", but may represent a different aksara.] ...joined by [a bhuta-sankhya figure, likewise not independently decoded word-by-word, but corroborated by the following commentary as] sixteen degrees and forty minutes, the inauspicious (ashubha) Chapa (i.e. Indrachapa) [becomes] Shikhi ("the crested one", i.e. Ketu/the upagraha named Ketu here). [As a verification/closing check:] when one sign (rashi) is added to [this] Ketu, the Sun, [reckoned] in signs-degrees-etc. (rashyadika), should result [i.e. the cycle closes back to the Sun's own position].

हिन्दी अर्थ

[स्पष्टीकरण: इस पंक्ति का आरम्भिक संयुक्ताक्षर पृष्ठ पर पूर्णतः मुद्रित है -- यह भौतिक किनारे की कोई कमी नहीं है, जैसा कि पहले अनुमानित किया गया था -- किन्तु इस मुद्रण के विभेदन में इसके ठीक-ठीक अक्षर निश्चयपूर्वक नहीं पढ़े जा सके; यहाँ अनुमानतः "र्य" के रूप में लिखा गया है, किंतु यह किसी अन्य अक्षर का भी हो सकता है।] ...सोलह अंश और चालीस कला [एक भूतसंख्या पद, जो शब्दशः स्वतंत्र रूप से नहीं पढ़ा जा सका, किन्तु आगे की टीका से पुष्ट है] जोड़ने पर अशुभ चाप (अर्थात् इन्द्रचाप) शिखी (अर्थात् केतु नामक उपग्रह) कहलाता है। [जाँच हेतु:] इस केतु में एक राशि जोड़ने पर राश्यादि रूप में सूर्य [की ही स्थिति] प्राप्त होनी चाहिए [अर्थात् चक्र पुनः सूर्य पर बंद हो जाता है]।

स्रोत: BPHS Ch.4, verse 8, Kashi Sanskrit Series No.220, PDF p.53 (printed page 22), line 2 ("ekaraashiyute ketau suuryo raashyaadiko bhavet") read cleanly from a 2500dpi crop, text clear and unambiguous. Line 1 ("[opening conjunct]shonaatyashtibhaagaishcha yutashchaapo'shubhah shikhii") read from a sequence of full-page 600dpi and higher-resolution (up to 4500dpi) crops. CORRECTION/DISCLOSURE: an earlier working pass mistakenly concluded the line's opening syllable(s) were physically absent from the scan (blank paper at a tight left-margin crop); on more careful re-crop and coordinate recalculation, this was found to be a mistargeted crop landing one text-line too high or too low, not a genuine scan defect -- the page's true left margin at this line is blank only up to its normal ~76pt indent (consistent with the indent of the surrounding verse lines), after which ink is fully present. The opening conjunct itself, however, remains genuinely hard to decode with confidence at this print's resolution and font compression; it is transcribed here as a best-effort "rya" (DISCLOSED, not asserted with certainty). The intended numeric value (16 degrees, 40 minutes, added to Indrachapa to yield Ketu/Shikhi) is independently confirmed via the page's own detailed commentary immediately following this verse, which explicitly restates the full five-part chain -- Dhuma, Vyatipata, Parivesha, Indrachapa, Ketu -- with exact figures, and explicitly closes the verse range as "5-8" ("is prakaar shloka 5 se 8 tak dhuumaadi panch apraakaash grahon kaa saadhan kahaa"), and includes the verification loop (Ketu + 1 sign = the Sun's own position) as an explicit check on the computation. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रवीन्दुलग्नगेष्वेषु वंशायुर्ज्ञाननाशनम् ॥ ९ ॥ एषां पश्चादर्कदोषाणां स्थितिः पद्मासनोदिता ॥

raviindulagnageshveshu vamshaayurjnaananaashanam || 9 || eshaam pashchaadarkadoshaanaam sthitih padmaasanoditaa ||

अंग्रेज़ी अर्थ

These [five apraksha-grahas -- Dhuma, Vyatipata, Parivesha, Indrachapa, and Ketu/Shikhi], when situated with (DISCLOSED: the compound "ravi-indu-lagna-geshu" is compressed/terse; its precise sense is confirmed not from grammar alone but from the page's own following commentary) the Sun, Moon, and Lagna [respectively], destroy [one's] lineage (vamsha), longevity (ayus), and wisdom (jnana) [respectively]. Following (pashchat) these, the position/status (sthiti) of these solar afflictions (arka-dosha) has been declared by the Lotus-seated one (padmasana, i.e. Brahma).

हिन्दी अर्थ

ये पाँच अप्रकाश ग्रह (धूम, व्यतीपात, परिवेष, इन्द्रचाप, तथा केतु/शिखी) क्रमशः सूर्य, चन्द्र, तथा लग्न से युक्त होने पर [स्पष्टीकरण: "रवीन्दुलग्नगेष्वेषु" संधि-पद संक्षिप्त है; इसका ठीक-ठीक अर्थ केवल व्याकरण से नहीं, अपितु पृष्ठ की आगे की टीका से पुष्ट है] क्रमशः वंश, आयु, तथा ज्ञान का नाश करते हैं। इनके पश्चात् इन अर्कदोषों (सौर-दोषों) की स्थिति पद्मासन (ब्रह्मा) द्वारा कही गई है।

स्रोत: BPHS Ch.4, verse 9, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.53 (main-text printed page 22), read from a clean 600dpi full-page render, text large and legible without further zoom. Closes the apraksha-graha (Dhuma etc.) section under the heading "apraakaash grahon kaa phal" (results of the non-luminous planets). NOTE ON VERSE-NUMBER PLACEMENT: the printed text places the running number "9" (॥९॥) after the verse's first line and a plain single danda (no number) after the second line; both lines are transcribed here together as verse 9, since the page's own Hindi commentary explicitly discusses both lines' content together before citing "॥९॥" at the very end of its paragraph ("...in paanch (dhuumaadi) arkadoshon kii sthiti brahmaajii ne kahii hai ॥9॥"), confirming the two lines form one unit rather than two separately-numbered verses. Independently corroborated by that same commentary ("upayukt dhuum aadi paanch apraakaash grah suurya, chandra yaa lagn se yukt hon to kramashah vansh, aayu aur gyaan kaa naash hotaa hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गुलिकादि-साधन— रविवारादिशन्यन्तं गुलिकादि निरूप्यते ॥ १० ॥

ravivaaraadishanyantam gulikaadi niruupyate || 10 ||

अंग्रेज़ी अर्थ

[Heading: "Computation of Gulika and the others".] Beginning from Sunday (ravi-vara) [and continuing] up to Saturn['s day] (shani), Gulika and the others [i.e. the seven day-lord-based upagrahas: Gulika, Yamaghantaka, Mrityu, Kalavela/Kaala, and Ardhaprahara -- named across the following verses] are [now] set forth (nirupyate, "is described").

हिन्दी अर्थ

[शीर्षक: "गुलिकादि-साधन"।] रविवार से आरम्भ कर शनिवार तक, गुलिक आदि (अर्थात् गुलिक, यमघण्टक, मृत्यु, कालवेला/काल, तथा अर्धप्रहर नामक वारेश-आधारित उपग्रह, जिनके नाम आगे के श्लोकों में दिए गए हैं) का निरूपण किया जाता है।

स्रोत: BPHS Ch.4, verse 10, Kashi Sanskrit Series No.220, PDF p.53 (main-text printed page 22), read from a clean 600dpi full-page render, text large and legible. Opens the Gulika-adi-sadhana (computation of Gulika and the other weekday-based upagrahas) section, continuing into verses 11-13 (verse 13 falling on the next page, PDF p.54/printed page 23). Independently corroborated by the page's own Hindi commentary spanning both pages ("suuryavaaraadi se shanivaar paryant gulik aadi kaa nirupan kiyaa jaataa hai -- dinamaan ko aath bhaag kar kramashah vaaresh se ganana karen..."). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दिवसानष्टधा कृत्वा वारेशाद् गणयेत् क्रमात् । अष्टमांशो निरीशः स्यात् छन्यंशो गुलिकः स्मृतः ॥ ११ ॥

divasaanashtadhaa kritvaa vaareshaad ganayet kramaat | ashtamaanshah niriishah syaat chhanyanshah gulikah smritah || 11 ||

अंग्रेज़ी अर्थ

Having divided the day (divasa) into eight (ashtadha) parts, one should count (ganayet) in order (kramat) from the lord of the [week]day (vareshat) [i.e. assign the seven planets as lords of the first seven eighth-parts of the day, in the weekday sequence starting from that day's own lord]. The eighth part (ashtamamsha) should be without a lord (nirisha) [DISCLOSED: the following word, transcribed here as "chhanyamshah", is not confidently decoded letter-by-word -- likely a compressed reference to "Saturn's part/portion", consistent with the following commentary's explicit statement that Saturn's eighth-part is called Gulika]; [that lordless/Saturn's] part is remembered as Gulika.

हिन्दी अर्थ

दिन को आठ भागों में विभाजित कर, वारेश (उस दिन के स्वामी ग्रह) से आरम्भ कर क्रमशः गणना करनी चाहिए [अर्थात् सप्ताह-क्रम में सात ग्रहों को प्रथम सात अष्टमांशों का स्वामी मानें]। आठवाँ भाग निरीश (स्वामीरहित) होता है [स्पष्टीकरण: अगला पद, जिसे यहाँ "छन्यंशः" के रूप में लिखा गया है, शब्दशः पूर्ण निश्चय के साथ नहीं पढ़ा जा सका -- सम्भवतः यह "शनि के भाग" का संक्षिप्त सूचक है, जो आगे की टीका के इस स्पष्ट कथन से मेल खाता है कि शनि का भाग गुलिक कहलाता है]; वह भाग गुलिक नाम से स्मरण किया गया है।

स्रोत: BPHS Ch.4, verse 11, Kashi Sanskrit Series No.220, PDF p.53 (main-text printed page 22), read from a clean 600dpi full-page render, text large and legible except for one compressed word (transcribed as "chhanyamshah") whose precise letter-by-letter decoding is uncertain. DISCLOSED: the intended sense (the eighth part, i.e. Saturn's part in the weekday sequence, is named Gulika) is independently and explicitly confirmed by the page's own Hindi commentary spanning this page and the next ("...athvaan bhaag yahaan bhi niriish yaa binaa swaamii kaa hotaa hai. shani kaa bhaag gulik, guru kaa yamaghant, bhaum kaa mrityu, ravi kaa kaalvelaa, budh kaa ardhaprahar hotaa hai || 10-13 ||"), which lists Gulika as specifically Saturn's portion. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रात्रिमप्यष्टधा भक्त्वा वारेशात् पञ्चमादितः । गणयेदष्टमः खण्डो निरीशः परिकीर्तितः ॥ १२ ॥

raatrimapyashtadhaa bhaktvaa vaareshaat panchamaaditah | ganayedashtamah khando niriishah parikiirtitah || 12 ||

अंग्रेज़ी अर्थ

Having divided the night (ratri) too into eight (ashtadha) [parts], one should count (ganayet), beginning from the fifth [planet] (panchamaditah) counted from the weekday-lord (vareshat) [i.e. for a night-birth, the eightfold assignment of planetary lords to the night's eighth-parts begins from the fifth planet in sequence from that day's own lord, rather than from the lord itself as in the daytime rule of verse 11]. The eighth division (ashtamah khandah) is declared (parikirtitah) [as before, in verse 11] to be without a lord (nirisha).

हिन्दी अर्थ

रात्रि को भी आठ भागों में विभाजित कर, वारेश से पाँचवें ग्रह से आरम्भ कर गणना करनी चाहिए [अर्थात् रात्रि में जन्म होने पर आठों भागों के अधिपतियों का क्रम वारेश से नहीं, अपितु वारेश से पाँचवें ग्रह से आरम्भ होता है, जबकि दिन के लिए यह क्रम श्लोक ११ के अनुसार वारेश से ही आरम्भ होता है]। आठवाँ भाग (जैसा पूर्व श्लोक में भी कहा गया) निरीश (स्वामीरहित) घोषित किया गया है।

स्रोत: BPHS Ch.4, verse 12, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.54 (main-text printed page 23), read from a clean 600dpi full-page render, text large and legible. Continues the Gulika-adi-sadhana section opened at verse 10 (previous page). Independently corroborated by the page's own Hindi commentary spanning verses 10-13 ("isi tarah raatrimaan ko bhi aath bhaagkar vaaresh se paanchven grah se aarambh kar saat grah pratham aadi saat bhaagon ke adhipati hote hain. aathvaan bhaag yahaan bhi niriish yaa binaa swaamii kaa hotaa hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शन्यंशो गुलिकः प्रोक्तो गुर्वंशो यमघण्टकः । भौमांशो मृत्युरादिष्टो रव्यंशः कालसंज्ञकः ॥ १३ ॥ सौम्यांशोऽर्धप्रहरकः स्पष्टः स्यात् स्वस्वदेशतः ।

shanyanshah gulikah prokto gurvanshah yamaghantakah | bhaumaanshah mrityuraadishto ravyanshah kaalasanjnakah || 13 || saumyaanshah ardhaprahara kah spashtah syaat svasvadeshatah |

अंग्रेज़ी अर्थ

Saturn's eighth-part (shanyamsha) is declared (prokta) Gulika; Jupiter's eighth-part (gurvamsha) [is] Yamaghantaka. Mars's eighth-part (bhaumamsha) is designated (adishta) Mrityu; the Sun's eighth-part (ravyamsha) is named (samjnaka) Kala [Kalavela]. Mercury's eighth-part (saumyamsha) [is] Ardhaprahara -- [each] should be made exact (spashta) according to one's own respective locality (sva-sva-deshatah, i.e. adjusted for local latitude/longitude).

हिन्दी अर्थ

शनि का अष्टमांश गुलिक कहा गया है; गुरु का अष्टमांश यमघण्टक है। मंगल का अष्टमांश मृत्यु नाम से बताया गया है; सूर्य का अष्टमांश काल (कालवेला) संज्ञक है। बुध का अष्टमांश अर्धप्रहर है -- [प्रत्येक को] अपने-अपने देश (स्थान) के अनुसार स्पष्ट (शुद्ध) करना चाहिए।

स्रोत: BPHS Ch.4, verse 13, Kashi Sanskrit Series No.220, PDF p.54 (main-text printed page 23), read from a clean 600dpi full-page render, text large and legible. Third line ("saumyaanshah ardhaprahara kah spashtah syaat svasvadeshatah") carries no separate verse-number in the print (single closing danda only) but is transcribed as part of verse 13, following the same convention already disclosed at verse 9: the page's Hindi commentary explicitly discusses all five upagraha-names (Gulika, Yamaghantaka, Mrityu, Kalavela, Ardhaprahara) together before citing the combined range "॥ १०-१३ ॥" ("shani kaa bhaag gulik, guru kaa yamaghant, bhaum kaa mrityu, ravi kaa kaalvelaa, budh kaa ardhaprahar hotaa hai ॥ 10-13 ॥"), confirming Mercury's Ardhaprahara belongs within this same verse unit. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गुलिक लग्न-साधन— गुलिकारम्भकालेष्ट-समयाश्रयतस्तु यत् ॥ १४ ॥

gulikaarambhakaaleshta-samayaashrayatastu yat || 14 ||

अंग्रेज़ी अर्थ

[Heading: "Computation of the Gulika-lagna".] That [ascendant] which [is derived] by relying upon (ashraya) the desired-moment (ishta-samaya) treated as the time of Gulika's commencement (gulikarambha-kala) [continues in the next verse]...

हिन्दी अर्थ

[शीर्षक: "गुलिक लग्न-साधन"।] गुलिक के आरम्भ-काल को ही इष्ट-समय मानकर, उसके आश्रय से जो [लग्न बनता है, वह आगे के श्लोक में बताया गया है]...

स्रोत: BPHS Ch.4, verse 14, Kashi Sanskrit Series No.220, PDF p.54 (main-text printed page 23), read from a clean 600dpi full-page render, text large and legible. Opens the Gulika-lagna-sadhana section; grammatically incomplete on its own, continuing directly into verse 15. Independently corroborated by the page's own Hindi commentary ("gulikaarambh kaal ko ishtasamay maankar jo lagnaanayan paddhati se lagna banaayaa jaay vahi gulik kahlaataa hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नं यत्साध्यते विद्धि गुलिकः स निगद्यते । नामान्तरं तु तस्यैव मान्दिरित्यभिधीयते ॥ १५ ॥

lagnam yatsaadhyate viddhi gulikah sa nigadyate | naamaantaram tu tasyaiva maandirityabhidhiiyate || 15 ||

अंग्रेज़ी अर्थ

[Continuing verse 14:] whatever lagna (ascendant) is thereby accomplished/derived (sadhyate) -- know (viddhi) that it is called (nigadyate) Gulika [in this secondary sense, the "Gulika-lagna"]. Its (tasya eva) alternate name (namantara) is stated (abhidhiyate) to be 'Mandi'.

हिन्दी अर्थ

[श्लोक १४ का शेषांश:] जो लग्न इस प्रकार साधा जाता है, उसे ही गुलिक (गुलिक-लग्न) कहा गया है, ऐसा जानो। उसी का नामांतर (दूसरा नाम) 'मान्दि' कहा गया है।

स्रोत: BPHS Ch.4, verse 15, Kashi Sanskrit Series No.220, PDF p.54 (main-text printed page 23), read from a clean 600dpi full-page render, text large and legible. Closes the two-verse (14-15) Gulika-lagna definition. Independently corroborated by the page's own Hindi commentary ("usi gulik kaa sangyaantar maandi bhi hai. dinagat ishtakaal hone par din ke gulikeisht se, evam raatrigat isht kaal rahne par raatrigat gulikeisht par se lagnaanayan karnaa hi svaabhaavik hai ॥ 14-15 ॥"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्राणपद की परिभाषा पलैस्तु तिथिभिः प्राणपदभं समुदीरितम् । इष्टकालोद्भवं तत्तु चराग्द्विभगे रवौ ॥ १६ ॥

palaistu tithibhih praanapadabham samudiiritam | ishtakaalodbhavam tattu [DISCLOSED-UNCERTAIN: charaagdvibhage] ravau || 16 ||

अंग्रेज़ी अर्थ

[Heading: "Definition of Pranapada".] By [treating the ishta-kala's] palas as [if they were] tithis (tithibhih), the Pranapada-sign (praanapada-bha) is declared (samudiritam). That [sign], arising from the ishta-kala (ishtakalodbhavam) -- [when the] Sun (ravau) [is in a movable/chara sign, add the raw Pranapada figure itself; DISCLOSED: the compressed compound naming the fixed (sthira) and dual (dvisvabhava) cases, transcribed here as best-effort "charagdvibhage", is not confidently decoded letter-by-letter at this print's resolution, but its intended sense is fully corroborated by the following commentary, see source] ...

हिन्दी अर्थ

[शीर्षक: "प्राणपद की परिभाषा"।] इष्टकाल के पलों को तिथि मानकर, प्राणपद-राशि कही गई है। इष्टकाल से उत्पन्न वह [राशि, सूर्य के चर राशिगत होने पर स्वयं ही प्राणपद होती है; स्पष्टीकरण: स्थिर व द्विस्वभाव राशियों की स्थिति बताने वाला संक्षिप्त पद, जिसे यहाँ अनुमानतः "चराग्द्विभगे" लिखा गया है, इस मुद्रण के विभेदन में अक्षरशः पूर्ण निश्चय से नहीं पढ़ा जा सका, किंतु इसका आशय आगे की टीका से पूर्णतः पुष्ट है, देखें source]...

स्रोत: BPHS Ch.4, verse 16 (line 1-2 of 3; verse continues onto the next line/page, cut short by a worked numerical example at the bottom of this page), Kashi Sanskrit Series No.220, PDF p.54 (main-text printed page 23), read from a clean 600dpi full-page render and a further direct-crop zoom (scratchpad/bphs-v16-band.png, scratchpad/bphs-v16-word-zoom.png) of the second line. Line 1 ("palaistu tithibhih praanapadabham samudiiritam") is clear and unambiguous. Line 2's final compound (preceding "ravau") is compressed/ligature-heavy and its exact letters (transcribed here as best-effort "charagdvibhage") are DISCLOSED as uncertain rather than asserted with confidence. The intended computational rule is nonetheless independently and explicitly confirmed by the page's own Hindi commentary: "chara-sthir-dvisvabhaav raashigat suurya mein ishtakaalik praanpad raashi ko kramashah suurya, suurya se navam, tathaa usase pancham raashi mein jod dene par spashta praanpad ho jaataa hai" -- i.e. when the Sun is in a movable (chara) sign the raw Pranapada-sign itself is used; when in a fixed (sthira) sign, the 9th sign from it is used; when in a dual (dvisvabhava) sign, the 5th sign from it is used, per verse 17 (not yet transcribed) which states the trine-based correction. A worked numerical example ("udaaharan") follows at the bottom of this page and is editorial commentary, not root verse text -- correctly excluded here per this project's BPHS copyright-safety discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्राणपद का साधन— घटी चतुर्गुणा कार्या तिथ्याप्तैश्च पलैर्युता ॥ १७ ॥

ghatii chaturgunaa kaaryaa tithyaaptaishcha palairyutaa || 17 ||

अंग्रेज़ी अर्थ

[Heading: "Computation of Pranapada".] The [ishta-kala's] ghati figure should be made fourfold (multiplied by four); and [to that] joined the palas obtained by dividing [that ghati-figure's remainder] by 'tithi' [a bhuta-sankhya (word-numeral) here denoting fifteen].

हिन्दी अर्थ

[शीर्षक: "प्राणपद का साधन"।] इष्टकाल की घटी को चौगुना (चार से गुणा) करना चाहिए; तथा उसमें तिथि [एक भूतसंख्या पद, यहाँ पन्द्रह (१५) का सूचक] से भाग देने पर प्राप्त पल जोड़ने चाहिए।

स्रोत: BPHS Ch.4, verse 17, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.55 (main-text printed page 24), read from a clean 600dpi full-page render, text large and legible. Opens the Pranapada-sadhana (computation method) section, following the definition already given at verse 16. Independently corroborated by the page's own Hindi commentary spanning verses 17-19 ("ishtaghatii ko chaar se gunaakar gunanaphal mein pandrah se pal mein bhaag lekar labdhi jod den"), which explicitly confirms "tithi" here denotes fifteen. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दिवाकर हृता शेषं राशिश्चाथ पलात्मकम् । पूर्वशेषं द्विगुणितं लवाः स्फुटमुदीरिताः ॥ १८ ॥

divaakara hritaa sheshah raashishchaatha palaatmakam | puurvashesham dviguNitam lavaah sphutamudiiritaah || 18 ||

अंग्रेज़ी अर्थ

Divided by 'divakara' [a bhuta-sankhya (word-numeral) here denoting twelve, i.e. the twelve signs], the remainder (shesha) [of the sum from verse 17] then [gives] the [Pranapada's] sign-number (rashi), of pala-nature (palatmaka) [i.e. the pala-based figure computed in v.17]. The earlier (purva) [pala-division] remainder, doubled (dvigunitam), [gives] the exact (sphuta) minutes/degrees (lavah), [so] declared.

हिन्दी अर्थ

'दिवाकर' [एक भूतसंख्या पद, यहाँ बारह (१२), अर्थात् बारह राशियों का सूचक] से भाग देने पर जो शेष बचे, वह पल-रूप (पूर्व श्लोक से प्राप्त) प्राणपद की राशि-संख्या है। पूर्व (पल-भाग का) शेष, दुगुना करने पर, स्पष्ट अंश (लवाः) कहा गया है।

स्रोत: BPHS Ch.4, verse 18, Kashi Sanskrit Series No.220, PDF p.55 (main-text printed page 24), read from a clean 600dpi full-page render, text large and legible. Independently corroborated by the page's own Hindi commentary ("yog mein 12 se tadit karen shesh ank ko raashi samajhen. palaatmak shesh ko dviguNit kar ansh samjhen"), which explicitly confirms "divakara" here denotes twelve, matching the standard bhuta-sankhya convention (Sun = twelve Adityas). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एवं राश्यंशकौ सूर्यतत्त्रिकोणभभागयोः । योजयेत् क्रमशो विज्ञश्चरादौ संस्थिते रवौ ॥ १९ ॥ स्फुटं राश्यादिकं प्राणपदं, तत् प्रोच्यते पुनः ।

evam raashyanshakau suuryatattrikoNabhabhaagayoh | yojayet kramasho vijnashcharaadau samsthite ravau || 19 || sphutam raashyaadikam praaNapadam tat prochyate punah |

अंग्रेज़ी अर्थ

Thus, the wise one (vijna) should add (yojayet), respectively/in due order (kramashah), the [above-obtained] sign-and-degree (rashy-amshakau) to the Sun's own [sign-and-degree], or to that of the Sun's trine (trikona) [i.e. its 9th or 5th sign-and-degree] -- according to the Sun being situated (samsthite) in a movable sign (chara) or otherwise [i.e. fixed/sthira or dual/dvisvabhava; per the rule already introduced at verse 16]. The resulting exact (sphuta) sign-degree-etc. is again (punah) declared (prochyate) to be the Pranapada.

हिन्दी अर्थ

इस प्रकार प्राप्त राशि-अंश को विज्ञ पुरुष सूर्य के अपने राशि-अंश में, अथवा सूर्य के त्रिकोण (नवम या पंचम) राशि-अंश में, सूर्य के चर राशिगत होने या अन्यथा (स्थिर/द्विस्वभाव) होने के अनुसार क्रमशः जोड़े [जैसा श्लोक १६ में पहले ही बताया गया है]। इस प्रकार प्राप्त स्पष्ट राशि-आदि को ही पुनः प्राणपद कहा जाता है।

स्रोत: BPHS Ch.4, verse 19, Kashi Sanskrit Series No.220, PDF p.55 (main-text printed page 24), read from a clean 600dpi full-page render, text large and legible. Closes the first Pranapada-computation method (verses 16-19), which the page's own commentary explicitly labels with the combined citation "॥ १७-१९ ॥" and restates in full ("is prakaar aagat raashi-ansh ko char-sthir-dvisvabhaav raashiyon mein suurya ki sthiti ke anusaar spashta suurya ke raashi-ansh mein, suurya se navam raashi ke raashi-ansh mein, tathaa suurya se pancham raashi ke raashi-ansh mein kramashah jod den to sphut praanapad ke raashi-ansh aadi hote hain"), confirming the trine-correction rule (9th for a fixed Sun, 5th for a dual-sign Sun, itself for a movable-sign Sun) disclosed at verse 16. A worked numerical example ("udaaharan") and a second alternative computation method (beginning at verse 20, heading "praanapad-saadhan kii duusri riiti") follow on this same page but are not yet transcribed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्राणपद-साधन की दूसरी रीति— स्वेष्टकालं पलीकृत्य तिथ्याप्तं भादिकं च यत् ॥ २० ॥

sveshtakaalam paliikritya tithyaaptam bhaadikam cha yat || 20 ||

अंग्रेज़ी अर्थ

[Heading: "The second method for computing Pranapada".] That which [results as] the sign-etc. (bhadikam) quotient by converting one's own desired-time (sva-ishta-kala) into palas and dividing by 'tithi' [a bhuta-sankhya (word-numeral) here denoting fifteen, as at verse 17] -- [continues in the next verse].

हिन्दी अर्थ

[शीर्षक: "प्राणपद-साधन की दूसरी रीति"।] अपने इष्टकाल को पल में बदलकर तथा तिथि [भूतसंख्या पद, यहाँ पन्द्रह (१५), जैसा श्लोक १७ में भी है] से भाग देने पर जो राश्यादि लब्धि प्राप्त हो -- [आगे के श्लोक में जारी]।

स्रोत: BPHS Ch.4, verse 20, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.55 (main-text printed page 24), read from a clean 600dpi full-page render, text large and legible. Opens a second, algebraically-equivalent method for computing Pranapada (the page's own following commentary on the NEXT page explicitly derives and defends the equivalence of both methods: "donon prakaar praanapad saadhan ke liye sarvathaa yuktiyukt hai"). Independently corroborated by that commentary's restatement: "ishtakaal ko pal banaakar 15 se bhaag den, jo raashyaadik labdhi aave". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चरागद्विभगे भानौ भानौ युङ् नवमे सुते । स्फुटं प्राणपदं तच्च लग्नतो नवमे सुते ॥ २१ ॥

charaagadvibhage bhaanau bhaanau yung navame sute | sphutam praaNapadam tachcha lagnato navame sute || 21 ||

अंग्रेज़ी अर्थ

[DISCLOSED: this verse's syntax is unusually dense/compressed, including what appear to be two occurrences each of "bhaanau" ("to the Sun") and "navame sute" ("in the ninth [house], to that born/produced"); it is not confidently parsed word-for-word, but transcribed exactly as printed.] Onto the Sun -- [added, per the threefold movable/fixed/dual-sign division already stated at verse 16 and again compressed here as "charagadvibhage"] -- [or] in the ninth from it: [that is how] the exact (sphuta) Pranapada [is obtained; and, taken] from the lagna, in the ninth [house from it, is one auspicious placement, continuing into the list of favorable houses given in the next verse].

हिन्दी अर्थ

[स्पष्टीकरण: इस श्लोक की वाक्य-रचना असामान्य रूप से संक्षिप्त/सघन है, जिसमें "भानौ" ("सूर्य में") तथा "नवमे सुते" ("नवम में उत्पन्न") प्रत्येक दो-दो बार प्रतीत होते हैं; इसे शब्दशः पूर्ण निश्चय के साथ नहीं पढ़ा जा सका, अपितु ठीक वैसे ही लिखा गया है जैसे मुद्रित है।] सूर्य में [श्लोक १६ में पहले ही बताए गए चर-स्थिर-द्विस्वभाव त्रिविध विभाजन के अनुसार, यहाँ पुनः "चरागद्विभगे" रूप में संक्षिप्त] जोड़ने पर, अथवा उससे नवम में -- इस प्रकार स्पष्ट प्राणपद प्राप्त होता है; तथा लग्न से नवम में [होना एक शुभ स्थिति है, जिसकी सूची आगे के श्लोक में जारी है]।

स्रोत: BPHS Ch.4, verse 21, Kashi Sanskrit Series No.220, PDF p.55 (main-text printed page 24), read from a clean 600dpi full-page render and a further direct-crop zoom (scratchpad/bphs-v21-zoom.png) at higher resolution -- the individual aksaras are clear and unambiguous at the letter level, confirming the printed reading "charaagadvibhage bhaanau bhaanau yung navame sute | sphutam praaNapadam tachcha lagnato navame sute || 21 ||" exactly, INCLUDING the apparent double occurrence of "bhaanau" and of "navame sute". DISCLOSED: despite the letters themselves being legible, the verse's intended grammatical parse/segmentation is not confidently resolved (whether this is a genuine shastric repetition-for-emphasis, an artifact of extreme metrical compression, or governs two separate sub-clauses is not established here). The overall computational sense (the same chara/sthira/dvisvabhava trine-correction rule as verses 16-19, applied to the verse-20 quotient) is independently corroborated by the page's own Hindi commentary: "use char-sthir-dvisvabhaav-gat suurya ke anusaar suurya, suurya se navam, tatha suurya se pancham raashi ke raashyansh mein kramashah jodne par praanapad ke sphut raashyaadi hote hain". The favorable-houses sense (Pranapada in the 9th from lagna being one auspicious placement) is likewise corroborated by that commentary's list of six favorable houses (2nd, 4th, 5th, 9th, 10th, 11th from lagna), continued in verse 22. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्वितीये दशमे लाभे तुर्ये वापि शुभप्रदम् । अन्यत्र संस्थितं तत्तु सुखदं नहि जन्मिनाम् ॥ २२ ॥

dvitiiye dashame laabhe turye vaapi shubhapradam | anyatra samsthitam tattu sukhadam nahi janminaam || 22 ||

अंग्रेज़ी अर्थ

[Pranapada, situated] in the 2nd, 10th, or 11th (labha) [house from the lagna], or else (vapi) in the 4th (turya), is auspicious (shubhaprada). Situated elsewhere (anyatra samsthitam), that [placement], however (tu), is not conducive to happiness/well-being (sukhada) for those born (janminam) [i.e. for the native].

हिन्दी अर्थ

[लग्न से] द्वितीय, दशम, अथवा लाभ (एकादश) में, अथवा चतुर्थ (तुर्य) में स्थित प्राणपद शुभप्रद है। अन्यत्र स्थित होने पर वह जातकों के लिए सुखदायक नहीं है।

स्रोत: BPHS Ch.4, verse 22, Kashi Sanskrit Series No.220, PDF p.55 (main-text printed page 24, final verse of the page), read from a clean 600dpi full-page render, text large and legible. Closes the second Pranapada-computation-and-results section (verses 20-22). Note: this verse names four favorable houses (2nd, 4th, 10th, 11th); the page's own Hindi commentary (on the following page, PDF p.56/printed page 25) states a fuller list of six favorable houses ("lagna se dwitiya, chaturth, pancham, navam, dasham tathaa ekaadashastha ho to jaatak ko sarvathaa saukhya"), adding the 5th and 9th -- the 9th being covered by verse 21's disclosed "navame" clause; the 5th (pancham) is not explicitly located in the root-verse text transcribed here and may be implicit in the same compressed passage. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पलभा की परिभाषा तथा उसके द्वारा चरखण्ड का साधन— मेषादौ सायनार्के तु दिनार्धजनिता हि या । द्वादशाङ्गुलशङ्कोर्भा पलभेत्युच्यते बुधैः ॥ २३ ॥

meshaadau saayanaarke tu dinaardhajanitaa hi yaa | dvaadashaangulashankorbhaa palabhetyuchyate budhaih || 23 ||

अंग्रेज़ी अर्थ

[Heading: "Definition of palabha, and computing the chara-khanda by means of it".] When the sayana (tropical) Sun is at the start (adi) of Aries (Mesha) -- that is, on an equinox day -- the shadow (bha) that is produced at midday (dinardha) by a twelve-angula gnomon (dvadashangula-shanku) is called 'palabha' by the wise (budhaih).

हिन्दी अर्थ

[शीर्षक: "पलभा की परिभाषा तथा उसके द्वारा चरखण्ड का साधन"।] जब सायन सूर्य मेष राशि के आरम्भ में हों, अर्थात् जब दिन-रात बराबर हों, तब मध्याह्न में बारह अंगुल के शंकु (गोमुख-यष्टि) से जो छाया उत्पन्न होती है, उसे विद्वानों ने 'पलभा' कहा है।

स्रोत: BPHS Ch.4, verse 23, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.57 (main-text printed page 26), read from a clean 600dpi full-page render, text large and legible. Opens a new section (palabha-pariksha/chara-khanda-sadhana) following the Pranapada material of the previous pages. Independently corroborated by the page's own Hindi commentary ("sayan-suurya meshaadigat jab hon, arthaat jab din-raat baraabar ho to madhyaahna samay mein 12 angul shanku ki chhaayaa palbhaa kahi jaati hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रिघ्ना सा गुणिता दिग्भिर्युजैर्दशभिः क्रमात् । त्रिभिर्हृताऽन्तिमगता भवेयुश्चरखण्डकाः ॥ २४ ॥

trighnaa saa guNitaa digbhiryujairdashabhih kramaat | tribhirhritaa'ntimagataa bhaveyushcharakhandakaah || 24 ||

अंग्रेज़ी अर्थ

That [palabha], multiplied respectively (kramat), in three placements, by [a set of bhuta-sankhya (word-numeral) multipliers here transcribed as] 'digbhi', 'yujaih', [and] 'dashabhih' [DISCLOSED: the precise word-by-word numeral values of this compressed compound are not independently derived here, but the following commentary explicitly gives them as ten, eight, and ten respectively] -- with the last (antima) of the three products divided by three (tribhih hrita) -- these become the [three] chara-khandas (ascensional-difference portions).

हिन्दी अर्थ

उस पलभा को, [एक भूतसंख्या पद-समूह, यहाँ "दिग्भिः", "युजैः", "दशभिः" के रूप में लिखा गया, जिसके ठीक-ठीक अंक-मान स्वतंत्र रूप से यहाँ नहीं निकाले गए, किन्तु आगे की टीका स्पष्ट रूप से इन्हें क्रमशः दस, आठ, तथा दस बताती है] तीन स्थानों में क्रमशः गुणा करने पर, अन्तिम (तीसरे) गुणनफल को तीन से भाग देने पर, [ये तीन परिणाम] चरखण्ड (उदयान्तर के तीन भाग) कहलाते हैं।

स्रोत: BPHS Ch.4, verse 24, Kashi Sanskrit Series No.220, PDF p.57 (main-text printed page 26), read from a clean 600dpi full-page render, text large and legible at the letter level, though the compressed bhuta-sankhya compound's precise word-segmentation is not independently confirmed. Independently and explicitly corroborated by the page's own Hindi commentary: "us palbhaa ko teen sthaanon mein rakhkar, 10, 8, 10 se kramashah gunaa karen aur antim gunanphal mein teen se bhaag bhi den to kramashah teen charakhand hote hain", and by the page's own worked example ("kaashi ki palbhaa 5.45 hai. atah (5|45)x10=57=pratham charakhand. (5|45)x8=46=dwitiya charakhand evam (5|45)x(10/3)=19-2/3=triitiya charakhand"). Closes the two-verse (23-24) palabha/chara-khanda section, explicitly cited by the commentary as "॥ २३-२४ ॥". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लङ्कोदय से स्वोदय का साधन— लङ्कोदया विघटिका गजभान्यङ्कगोऽश्विनः । त्रिपक्षदहना एताः क्रमोत्क्रमगताः पुनः ॥ २५ ॥

lankodayaa vighatikaa gajabhaanyankagoashvinah | tripakshadahanaa etaah kramotkramagataah punah || 25 ||

अंग्रेज़ी अर्थ

[Heading: "Computing Svodaya (local rising-time) from Lankodaya (equatorial rising-time)".] The Lankodaya (equatorial rising-time) figures, in vighatikas, [are given by a bhuta-sankhya (word-numeral) compound here transcribed as] 'gaja-bha-anka-go-ashvinah' [DISCLOSED: not independently decoded word-by-word, but strongly corroborated -- see source -- as the three standard values 278, 299, and 323, one for each pair of signs counted from Mesha/Meena inward]; these, again, [are to be] applied in forward and reverse order (kramotkrama-gataah) [DISCLOSED: the preceding word "tripakshadahanaa" is likewise not confidently decoded letter-by-letter].

हिन्दी अर्थ

[शीर्षक: "लंकोदय से स्वोदय का साधन"।] लंकोदय (भूमध्यरेखा पर उदयकाल) के विघटिका-मान, [एक भूतसंख्या पद-समूह, यहाँ "गजभान्यंकगोऽश्विनः" के रूप में लिखा गया; स्पष्टीकरण: शब्दशः स्वतंत्र रूप से नहीं पढ़ा जा सका, किन्तु दृढ़तापूर्वक पुष्ट है -- देखें source -- मेष/मीन आदि राशि-युग्मों के लिए मानक तीन मान २७८, २९९, तथा ३२३ के रूप में]; ये पुनः क्रम व उत्क्रम (आगे व पीछे के क्रम) में प्रयुक्त होते हैं [स्पष्टीकरण: पूर्ववर्ती पद "त्रिपक्षदहना" भी शब्दशः पूर्ण निश्चय के साथ नहीं पढ़ा जा सका]।

स्रोत: BPHS Ch.4, verse 25, Kashi Sanskrit Series No.220, PDF p.57 (main-text printed page 26), read from a clean 600dpi full-page render, text large and legible at the letter level; the two bhuta-sankhya/technical compounds noted above are DISCLOSED as not independently word-parsed. The intended numeric values (278, 299, 323 vighatikas -- the standard Surya-Siddhanta-tradition equatorial rising-times for the three sign-pairs Mesha-Meena, Vrishabha-Kumbha, and Mithuna-Makara) are independently and explicitly confirmed by the page's own worked example immediately below verse 24 ("278, 299, 323, palon ko kram evam utkram se rakhkar...") and by the following verse's (26) commentary, which uses these same three figures throughout its worked "kaashi kaa swodaya-maan" table. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

क्रमोत्क्रमस्थितैर्हीनयुताश्चरदलैस्तदा । स्वोदयाः स्युः क्रमान्मेषातुलादेरुत्क्रमात्तथा ॥ २६ ॥

kramotkramasthitairhiinayutaashcharadalaistadaa | svodayaah syuh kramaanmeshaatulaaderutkramaattathaa || 26 ||

अंग्रेज़ी अर्थ

Then, those [Lankodaya figures] arranged in forward-and-reverse order (kramotkrama-sthitaih), diminished or increased (hina-yutah) by the chara-dala (half of the chara-khandas obtained at verse 24) -- thus the svodaya (local rising-time) figures result, in forward order (kramat) starting from Mesha [Aries, for the first six signs], and, likewise, in reverse order (utkramat) starting from Tula [Libra, for the remaining six].

हिन्दी अर्थ

तब उन (लंकोदय) मानों को क्रम व उत्क्रम में रखकर, चरदल (चरखण्ड के आधे भाग) से घटाने या जोड़ने पर, स्वोदय (अपने स्थान का उदयकाल) मान प्राप्त होते हैं -- मेष से आरम्भ कर क्रम से (प्रथम छह राशियों के लिए), तथा इसी प्रकार तुला से आरम्भ कर उत्क्रम से (शेष छह राशियों के लिए)।

स्रोत: BPHS Ch.4, verse 26, Kashi Sanskrit Series No.220, PDF p.57 (main-text printed page 26), read from a clean 600dpi full-page render, text large and legible. Closes the two-verse (25-26) Svodaya-sadhana section, explicitly cited by the commentary as "॥ २५-२६ ॥". Independently corroborated by that commentary ("278, 299, 323 palon ko kram evam utkram se rakhkar kramotkramasthit charakhandon ko pratham teen sthaanon mein hiin, agrim teen sthaanon mein yut karen to meshaadi 6 raashiyon ke kram se, aur tulaadi shesh raashiyon ke utkram se swodaya-maan hote hain") and by the page's own worked "kaashi kaa swodaya-maan" table immediately following, which computes all six sign-pair svodaya values by exactly this subtract/add, forward/reverse procedure. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्न-साधन-विधि— स्फुटोऽर्कः सायनः कार्यो भुक्तभोग्यांशकाश्च ये । स्वीयोदयगुणा त्रिंशद्भक्ताः कालास्तदाह्वयाः ॥ २७ ॥

sphuto'rkah saayanah kaaryo bhuktabhogyaanshakaashcha ye | sviiyodayagunaa trimshadbhaktaah kaalaastadaahvayaah || 27 ||

अंग्रेज़ी अर्थ

[Heading: "The method for computing the Lagna (ascendant)".] The exact (sphuta) Sun should be made sayana (tropical, by adding the current ayanamsha). And whichever degrees (amshakah) are its bhukta (already-elapsed) and bhogya (yet-to-elapse) portions [within its own sign] -- these, multiplied by their own [sign's] udaya[mana] (rising-time, as obtained in verses 25-26) and divided by thirty (trimshad-bhaktah), become the [respectively-named] times (kalah) called by those same names [i.e. 'bhukta-kala' and 'bhogya-kala'].

हिन्दी अर्थ

[शीर्षक: "लग्न-साधन-विधि"।] स्फुट सूर्य को सायन करना चाहिए (अर्थात् तात्कालिक अयनांश जोड़ना चाहिए)। और जो उसके अपने राशि में भुक्त (बीत चुके) तथा भोग्य (शेष) अंश हों, उन्हें अपने-अपने (राशि के) उदयमान (श्लोक २५-२६ से प्राप्त) से गुणा कर तीस से भाग देने पर, उन्हीं नामों से पुकारे जाने वाले काल (भुक्तकाल तथा भोग्यकाल) प्राप्त होते हैं।

स्रोत: BPHS Ch.4, verse 27, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.58 (main-text printed page 27), read from a clean 600dpi full-page render and a further direct bottom-margin crop (scratchpad/bphs-p57-bottom.png, taken from the previous page's full-resolution render) confirming the complete, unambiguous, non-truncated text ending at the verse-27 numeral. Opens the lagna-sadhana-vidhi (ascendant-computation method) section under that explicit heading. Independently corroborated by the page's own Hindi commentary ("jis samay spashta lagna banaana ho, us samay ke spashta suurya mein taatkaalik ayanaansh jodne se saayan suurya hota hai. us saayanaark ke bhukta yaa bhogya anshaadi ko us raashi ke udayamaan se gunaa kar 30 se bhaag den labdhi bhukta yaa bhogya kaal hota hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अभीष्टनाडीपलतो भोग्यकालान् विशोधयेत् । ततश्चाग्रिमराशीनां स्वोदयांश्चाथ शेषकम् ॥ २८ ॥

abhiishtanaadiipalato bhogyakaalaan vishodhayet | tatashchaagrimaraashiinaam svodayaamshchaatha sheshakam || 28 ||

अंग्रेज़ी अर्थ

One should subtract the bhogya-kala [obtained in verse 27] from the desired [time's] nadi-palas (ishta-nadi-pala, i.e. the ishta-kala expressed in ghati-palas). Then, from that remainder, [subtract] the svodaya (local rising-time) figures of the successive (agrima) signs one by one, [continuing] until a further remainder (sheshakam) is left [that is smaller than the next sign's svodaya].

हिन्दी अर्थ

अभीष्ट नाड़ी-पल (इष्टकाल का घटी-पल रूप) में से भोग्यकाल (श्लोक २७ से प्राप्त) घटाना चाहिए। तत्पश्चात् उस शेष में से आगे की राशियों के स्वोदय-मान क्रमशः घटाते जाना चाहिए, जब तक कि [अगली राशि के स्वोदय-मान से छोटा] शेष न बच जाए।

स्रोत: BPHS Ch.4, verse 28, Kashi Sanskrit Series No.220, PDF p.58 (main-text printed page 27), read from a clean 600dpi full-page render, text large and legible. Opens the 'bhogya-prakara' (bhogya-method) half of the two parallel lagna-sadhana procedures (the other, 'bhukta-prakara', being given at verse 30). Independently corroborated by the page's own Hindi commentary ("bhogya prakaar se lagna-saadhan karte samay bhogya kaal ko ishtanaadiipal mein ghataakar shesh mein agrim raashiyon ke udaya-maanon ko [jahaan tak ghata sake] ghataaven"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रिशता गुणितं भक्तमशुद्धोदयतः फलम् । लवाद्यं सहितं मेषादिकैः शुद्धैस्तु राशिभिः ॥ २९ ॥

trishataa gunitam bhaktamashuddhodayatah phalam | lavaadyam sahitam meshaadikaih shuddhaistu raashibhih || 29 ||

अंग्रेज़ी अर्थ

[That final remainder from verse 28,] multiplied by 'trishata' [DISCLOSED: printed exactly as written here, literally "three hundred"; however, the page's own commentary and worked example instead use thirty at the equivalent step -- consistent with verse 27's own explicit "trimshad-bhaktah" (divided by thirty) -- so this may be a print variant of "trimshata" ("by thirty") rather than a genuinely different multiplier; transcribed exactly as printed without silent correction] and divided (bhaktam) by the [next, still-]unexhausted (ashuddha) sign's udaya[mana] -- the resulting quotient (phalam), [expressed as] degrees etc. (lavadyam), is added (sahitam) to the count of the [already-]exhausted (shuddhaih) signs, reckoned from Aries (meshadikaih) onward.

हिन्दी अर्थ

[श्लोक २८ के शेष को] 'त्रिशता' [स्पष्टीकरण: यहाँ ठीक इसी रूप में मुद्रित है, अर्थात् शब्दशः "तीन सौ"; परन्तु पृष्ठ की अपनी टीका तथा उदाहरण इसी चरण में तीस (३०) का ही प्रयोग करते हैं -- जो श्लोक २७ के अपने स्पष्ट "त्रिंशद्भक्ताः" (तीस से भाग) से भी मेल खाता है -- अतः यह सम्भवतः "त्रिंशता" (तीस से) का ही मुद्रण-भेद हो सकता है, न कि वास्तव में भिन्न गुणक; यहाँ ठीक वैसे ही लिखा गया है जैसे मुद्रित है, बिना मौन सुधार के] से गुणा कर, आगे की अशुद्ध (शेष) राशि के उदयमान से भाग देने पर जो अंशादि लब्धि (फल) प्राप्त हो, उसे मेष से गिनी गई शुद्ध (बीत चुकी) राशियों की संख्या में जोड़ देना चाहिए।

स्रोत: BPHS Ch.4, verse 29, Kashi Sanskrit Series No.220, PDF p.58 (main-text printed page 27), read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p58-v2829-band.png) confirming the printed word "त्रिशता" unambiguously at the letter level, with no anusvara/bindu over the sha -- i.e. it is NOT visually distinguishable from "trishata" (three hundred) in this printing, though the numeric-consistency discrepancy with verse 27 and the commentary is explicitly disclosed above. Independently corroborated by the page's own Hindi commentary describing this same overall step ("is prakaar aagat shesh ko 30 se gunaakar ashuddhodaya maan se bhaag dene par jo anshaadik labdhi aave use, bhogya prakaar mein shuddha raashisankhyaa mein jodne se... saayan spashtalagna hota hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भुक्ते विधौ भुक्तकालान् षष्टिशुद्धेष्टकालतः । विशोध्य, गतराशीनां स्वोदयांस्तत्र शोधयेत् ॥ ३० ॥

bhukte vidhau bhuktakaalaan shashtishuddheshtakaalatah | vishodhya gataraashiinaam svodayaamstatra shodhayet || 30 ||

अंग्रेज़ी अर्थ

In the bhukta-method (bhukte vidhau) -- [the alternative procedure, contrasted with the bhogya-method of verses 28-29] -- having subtracted (vishodhya) the bhukta-kala [of verse 27] from the ishta-kala [after it has been] reduced by sixty (shashti-shuddha) [DISCLOSED: the precise sense of this sixty-based reduction is not independently re-derived here from grammar alone, but is read together with the page's own worked example], one should then subtract, from that [remainder], the svodaya (rising-time) figures of the elapsed (gata) signs [one by one].

हिन्दी अर्थ

भुक्त-विधि में -- [श्लोक २८-२९ की भोग्य-विधि के विपरीत, दूसरी वैकल्पिक रीति] -- साठ से शुद्ध किए गए इष्टकाल में से भुक्तकाल (श्लोक २७ से प्राप्त) घटाकर [स्पष्टीकरण: इस साठ-आधारित संशोधन का ठीक-ठीक अभिप्राय केवल व्याकरण से स्वतंत्र रूप से यहाँ पुनः नहीं निकाला गया, अपितु पृष्ठ के अपने उदाहरण के साथ मिलाकर समझा गया है], उस शेष में से बीत चुकी (गत) राशियों के स्वोदय-मान क्रमशः घटाने चाहिए।

स्रोत: BPHS Ch.4, verse 30, Kashi Sanskrit Series No.220, PDF p.58 (main-text printed page 27), read from a clean 600dpi full-page render and a further direct word-level zoom crop (scratchpad/bphs-p58-v30-word2.png) that corrected an initial misreading of the opening word: the printed akshara is "भु" (bhu), not "शु" (shu) -- i.e. "भुक्ते विधौ भुक्तकालान्" ("in the bhukta-method, the bhukta-kalas"), which is internally consistent with the surrounding bhukta/bhogya terminology, not the initially-misread "शुक्रे विधौ शुक्तकालान्". Opens the 'bhukta-prakara' (bhukta-method), the alternative to the 'bhogya-prakara' of verses 28-29, matching the commentary's explicit two-method framing ("...bhogya prakaar mein shuddha raashisankhyaa mein jodne se, aur bhukta prakaar mein ashuddha raashisankhyaa mein ghataane se saayan spashtalagna hota hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लवाद्यं तु फलं शुद्धमशुद्धाजादिराशितः । अयनांशविहीनं सत् स्फुटं लग्नं प्रजायते ॥ ३१ ॥ षड्राशिसहितं तच्च सप्तमं भवनं मतम् ।

lavaadyam tu phalam shuddhamashuddhaajaadiraashitah | ayanaanshavihiinam sat sphutam lagnam prajaayate || 31 || shadraashisahitam tachcha saptamam bhavanam matam |

अंग्रेज़ी अर्थ

That resulting degrees-etc. (lavadyam) quotient (phalam), [in the bhukta-method] added onto the [already-]exhausted (shuddham) sign-count, or [in the bhogya-method, per verse 29,] [counted] from the [still-]unexhausted (ashuddha) sign onward, starting from Aries (ajadi) -- that [figure], once made free of the ayanamsha (ayanamsha-vihinam), becomes the exact (sphuta) [nirayana, sidereal] Lagna (ascendant). And that [Lagna], joined together with (sahitam) six signs (shad-rashi) [i.e. counted seven signs from it, or equivalently the opposite sign], is held (matam) to be the seventh house (saptama-bhavana).

हिन्दी अर्थ

वह प्राप्त अंशादि फल, [भुक्त-विधि में] शुद्ध (बीत चुकी) राशि-संख्या में जोड़ने पर, अथवा [श्लोक २९ की भोग्य-विधि में] मेष से गिनी गई अशुद्ध राशि से आगे गिनने पर -- वह [परिणाम], अयनांश-रहित करने पर, स्पष्ट (निरयण) लग्न कहलाता है। और वह लग्न, छह राशि सहित (अर्थात् उससे सातवीं राशि), सप्तम भवन माना गया है।

स्रोत: BPHS Ch.4, verse 31, Kashi Sanskrit Series No.220, PDF p.58 (main-text printed page 27), read from a clean 600dpi full-page render, text large and legible; the trailing unnumbered line ("shadraashisahitam tachcha saptamam bhavanam matam") carries no separate verse-number in the print and is transcribed together with verse 31 as one unit, consistent with the same convention already used at verses 9 and 19 in this chapter. Closes the five-verse (27-31) lagna-sadhana-vidhi section, which the page's own Hindi commentary explicitly cites as a combined unit ("...is prakaar spashta lagna nikaalne kii yah vidhi kahii gaii || 27-31 ||") and restates step-by-step, including the final ayanamsha-subtraction and the seventh-house (saptama-bhava) rule of adding six signs. A worked numerical example ("udaaharan") follows immediately on this same page but is not transcribed here, consistent with this project's exclusion of editorial worked-example content. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भुक्त भोग्य काल की अल्पता में विशेष— स्वेष्टकालान्न संशुद्धेद् भुक्तं भोग्यं यदा तदा । त्रिशता गुणितं स्वेष्टं स्वोदयाप्तं लवादिकम् ॥ ३२ ॥ यत्तद्धीनं युतं कार्यं रवौ लग्नं स्फुटं भवेत् ।

sveshtakaalaanna sanshuddhedbhuktam bhogyam yadaa tadaa | trishataa gunitam sveshtam svodayaaptam lavaadikam || 32 || yattaddhiinam yutam kaaryam ravau lagnam sphutam bhavet |

अंग्रेज़ी अर्थ

[Heading: "A special rule for when the bhukta or bhogya-kala is [too] small [to be subtracted from the ishta-ghati-pala as in verses 28/30]".] When the bhukta or bhogya [kala, from verse 27,] cannot be subtracted (na sanshuddhet) from one's own ishta-kala [as the ordinary procedure requires] -- then, one's own ishta [ghati], multiplied by 'trishata' [DISCLOSED: printed exactly as at verse 29, literally "three hundred", but the page's own following worked example explicitly multiplies the ishta-ghati by thirty at this step, matching verse 27's own "trimshad-bhaktah"; transcribed exactly as printed] and divided by its own [sign's] udaya[mana], gives the degrees-etc. (lavadikam) [quotient]. That [quotient], decreased or increased (hina-yutam) [as the bhukta/bhogya case requires], should be applied (karyam) to the Sun (ravau); [thus] the exact (sphuta) lagna results.

हिन्दी अर्थ

[शीर्षक: "भुक्त भोग्य काल की अल्पता में विशेष"।] जब भुक्त या भोग्यकाल (श्लोक २७ से प्राप्त) अपने इष्टकाल में से [सामान्य विधि के अनुसार, श्लोक २८/३० जैसे] घटाया न जा सके, तब अपने इष्टघटी को 'त्रिशता' [स्पष्टीकरण: श्लोक २९ के समान ही यहाँ भी मुद्रित रूप में शब्दशः "तीन सौ"; परन्तु पृष्ठ का अपना उदाहरण इसी चरण में इष्टघटी को तीस (३०) से ही गुणा करता है, जो श्लोक २७ के "त्रिंशद्भक्ताः" से भी मेल खाता है; यहाँ ठीक वैसे ही लिखा गया है जैसे मुद्रित है] से गुणा कर अपने उदयमान से भाग देने पर अंशादि लब्धि प्राप्त होती है। उस लब्धि को [भुक्त या भोग्य की स्थिति के अनुसार] हीन या युत कर सूर्य में लगाने पर स्पष्ट लग्न प्राप्त होता है।

स्रोत: BPHS Ch.4, verse 32, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.59 (main-text printed page 28), read from a clean 600dpi full-page render, text large and legible. The heading, verse text (with running number 32 after its second line), and a further unnumbered continuation line are transcribed together as one unit, consistent with the convention already used at verses 9, 19, and 31 of this chapter. This exception rule follows immediately after the page's own worked numerical example for verses 27-31 (explicitly closed there with the citation "॥२७-३१॥"), addressing the case where the ishta-ghati-pala is too small for the ordinary bhukta/bhogya subtraction. Independently corroborated by the page's own following commentary and worked example ("yadi purv mein aaniit bhukta yaa bhogyakaal isht ghatii-pal mein nahiin ghate to ishtaghatii ko 30 se gunaakar apne udayamaan se bhaag den. bhaag dene par praapt anshaadi phal ko spashta suurya mein kramashah hiin-yut karen... to spashta lagna ho jaayegaa"), which explicitly uses thirty (not three hundred) at the corresponding step -- the same disclosed numeral discrepancy already noted at verse 29. A worked example ("udaaharanah") follows on this page but is not transcribed here. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नतोन्नत-परिज्ञान— द्युरात्रिगतशेषेष्टघट्योरल्पं तदुन्नतम् ॥ ३३ ॥ नतं दिननिशोर्द्धं उन्नतोनं प्रकीर्तितम् ।

dyuraatrigatasheshestaghatyoralpam tadunnatam || 33 || natam dinanishordham unnatonam prakiirtitam |

अंग्रेज़ी अर्थ

[Heading: "Knowledge of nata (depressed) and unnata (elevated) [time]".] Of the elapsed (gata) and remaining (shesha) ishta-ghatis of day and night (dyu-ratri), whichever is smaller (alpam) -- that is called unnata (elevated). Nata (depressed) is declared (prakirtitam) [to be] half of day-or-night (dina-nisho-ardham), diminished by unnata (unnatonam).

हिन्दी अर्थ

[शीर्षक: "नत तथा उन्नत [काल] का परिज्ञान"।] दिन-रात्रि की गत तथा शेष इष्ट-घटियों में से जो अल्प (छोटी) हो, वह उन्नत काल कहलाता है। दिन अथवा रात्रि के आधे (अर्द्ध) में से उन्नत घटाने पर जो बचे, वह नत काल कहा गया है।

स्रोत: BPHS Ch.4, verse 33, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.60 (main-text printed page 29), read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p60-v33.png) confirming the printed text letter-by-letter, including the sandhi-joined "dinanishordham unnatonam" (dina-nisho-ardham + unnatonam). Opens the nata/unnata section under that explicit heading, immediately following the lagna-sadhana-vidhi (verses 27-32). Independently corroborated by the page's own Hindi commentary ("din aur raatri donon ki gatghatii aur sheshghatii in donon mein jo alp ho use unnat kaal kahte hain. unnat kaal ko dinadal yaa raatridal mein ghataane se shesh natakaal hota hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दशमलग्न-साधनविधि— नतात्पलीकृतात्पूर्वापरस्माद् भुक्तभोग्यतः ॥ ३४ ॥

nataatpaliikritaatpuurvaaparasmaad bhuktabhogyatah || 34 ||

अंग्रेज़ी अर्थ

[Heading: "The method for computing the Dashama-lagna (the 10th house/meridian)".] From the nata [of verse 33], converted into palas, [and reckoned as] purva (before [noon], i.e. a morning nata) or apara (after, i.e. an afternoon/evening nata) -- by the bhukta or bhogya method respectively [continues in verse 35] --

हिन्दी अर्थ

[शीर्षक: "दशमलग्न-साधनविधि"।] नत (श्लोक ३३ से प्राप्त) को पल में बदलकर, तथा उसे पूर्व (दोपहर से पहले का नत) अथवा अपर (दोपहर के बाद का नत) मानकर -- क्रमशः भुक्त अथवा भोग्य विधि द्वारा -- [आगे श्लोक ३५ में जारी] --

स्रोत: BPHS Ch.4, verse 34 (first half of the two-verse unit 34-35), Kashi Sanskrit Series No.220, PDF p.60 (main-text printed page 29), read from a clean 600dpi full-page render, text large and legible. Opens the dashama-lagna-sadhana-vidhi (10th-house/meridian computation method) section. Independently corroborated by the page's own Hindi commentary, which explicitly treats verses 34-35 as one combined procedure ("purvanat mein lankoday par se bhukta prakaar dwaara, pashchimanat mein lankoday par se bhogya prakaar dwaara jo lagna-saadhan kiya jaata hai vahi dashamlagna hota hai"), closed with the combined citation "॥३४-३५॥". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लङ्कोदयैः साध्यते यल्लग्नं तदशमाभिधम् । सषड्भे दशमे ज्ञेयं चतुर्थं द्विजसत्तम ॥ ३५ ॥

lankodayaih saadhyate yallagnam tadashamaabhidham | sashadbhe dashame jneyam chaturtham dvijasattama || 35 ||

अंग्रेज़ी अर्थ

[Continuing from verse 34:] whichever lagna is computed (sadhyate) by means of the Lankodaya (equatorial rising-time, as at verse 25) figures [rather than the Svodaya figures used for the ordinary lagna of verses 27-32] -- that is called (abhidham) the Dashama (10th house/meridian). And, O best of the twice-born (dvija-sattama), the 4th house should be known (jneyam) as that Dashama-lagna joined with six signs (sa-shadbhe, i.e. the seventh sign from it).

हिन्दी अर्थ

[श्लोक ३४ से आगे:] लंकोदय (श्लोक २५ के समतुल्य-रेखा उदयकाल) मानों के द्वारा जो लग्न साधित किया जाता है [न कि श्लोक २७-३२ के सामान्य लग्न-साधन में प्रयुक्त स्वोदय मानों के द्वारा] -- वही दशम (दशम भवन/मध्याह्न-रेखा) कहलाता है। और, हे द्विजसत्तम, उस दशम-लग्न में छह राशि जोड़ने पर चतुर्थ भवन जानना चाहिए।

स्रोत: BPHS Ch.4, verse 35, Kashi Sanskrit Series No.220, PDF p.60 (main-text printed page 29), read from a clean 600dpi full-page render, text large and legible. Closes the two-verse (34-35) dashama-lagna-sadhana section, explicitly cited by the commentary as "॥३४-३५॥" and restated in full ("...dashama lagna mein 6 raashi jodne par chaturtha lagna hota hai"), and further corroborated by the page's own worked example, which computes the 1st, 4th, 7th, and 10th lagnas together and closes with the same combined citation. A worked numerical example follows on this page but is not transcribed here, consistent with this project's exclusion of editorial worked-example content. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शेष भाव और सन्धियों का साधन— लग्नं सुखात् सुखं कामाद् विशोध्य त्रिभिराहरेत् । एकांशं द्विगुणश्चापि युञ्ज्याल्लग्नचतुर्थयोः ॥ ३६ ॥

lagnam sukhaat sukham kaamaad vishodhya tribhiraharet | ekaansham dviguNashchaapi yunjyaallagnachaturthayoh || 36 ||

अंग्रेज़ी अर्थ

[Heading: "Computing the remaining houses and the sandhis (cusps)".] Having subtracted the Lagna (1st house) from Sukha (the 4th house), and Sukha from Kama (the 7th house), one should divide each [difference] by three (tribhih). The single (one-third) portion (ekaamsham), as well as the doubled (two-thirds) portion (dvigunashchapi), should then be added (yunjyat), respectively, to the Lagna and to the 4th [to obtain the 2nd and 3rd houses from the first difference, and the 5th and 6th houses from the second].

हिन्दी अर्थ

[शीर्षक: "शेष भावों तथा सन्धियों का साधन"।] लग्न (प्रथम भाव) को सुख (चतुर्थ भाव) में से, तथा सुख को काम (सप्तम भाव) में से घटाकर, प्रत्येक अन्तर को तीन से भाग देना चाहिए। एक अंश (एक-तिहाई भाग) तथा द्विगुणित (दो-तिहाई भाग) को क्रमशः लग्न तथा चतुर्थ में जोड़ने से [पहले अन्तर से द्वितीय व तृतीय भाव, तथा दूसरे अन्तर से पंचम व षष्ठ भाव प्राप्त होते हैं]।

स्रोत: BPHS Ch.4, verse 36, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.61 (main-text printed page 30), read from a clean 600dpi full-page render, text large and legible. Opens the shesha-bhava-sandhi-sadhana (computing the remaining houses and cusps) section. "Sukha" (4th house) and "Kama" (7th house) are here read per the page's own worked example, which explicitly labels its computed values "chaturtha lagna" and "saptama lagna" at exactly this step. Independently corroborated by the page's own Hindi commentary ("pratham lagna ko chaturth lagna mein aur chaturth lagna ko saptam lagna mein ghataakar tiin se alag-alag bhaag den. ekgunit pratham labdhi ko lagna mein jodne se dwitiiya bhaav, dviguNit usii labdhi ko lagna mein jodne se tritiiya bhaav hote hain"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षड्भावाः सन्धयश्चैवं पूर्वापरयुतेर्दलात् । ससन्धयः षडेवं ते भार्धयुक्ताः परेऽपि च ॥ ३७ ॥

shadbhaavaah sandhayashchaivam puurvaaparayuterdalaat | sasandhayah shadevam te bhaardhayuktaah pare'pi cha || 37 ||

अंग्रेज़ी अर्थ

Thus (evam), the six houses [1st through 6th, obtained via verses 34-36] and the sandhis (junction-points/cusps between successive houses) [are both established] -- the latter from half (dalat) the sum (yuti) of each preceding-and-following (purva-apara) [pair of house-longitudes]. These same six [houses], together with their sandhis (sa-sandhayah), when likewise (evam) joined with six signs (bha-ardha-yuktah) [DISCLOSED: "bhaardha", literally "half the zodiac", here denotes the standard six-sign addition already used at verses 31 and 35] -- give the other [remaining six houses and their sandhis] as well (pare'pi cha).

हिन्दी अर्थ

इस प्रकार (एवं) छह भाव [श्लोक ३४-३६ से प्राप्त प्रथम से षष्ठ तक] तथा सन्धियाँ (परस्पर सटे भावों के मिलन-बिन्दु) दोनों सिद्ध होते हैं -- सन्धि प्रत्येक पूर्व-अपर (आगे-पीछे के) भाव-युगल के योग के आधे (दल) से प्राप्त होती है। इन्हीं छह भावों को, अपनी-अपनी सन्धियों सहित, इसी प्रकार छह राशि जोड़ने पर [स्पष्टीकरण: "भार्ध" अर्थात् "राशिचक्र का आधा भाग", यहाँ श्लोक ३१ तथा ३५ में प्रयुक्त छह-राशि जोड़ने के नियम का ही सूचक है] शेष अन्य [छह भाव तथा उनकी सन्धियाँ] भी प्राप्त हो जाते हैं।

स्रोत: BPHS Ch.4, verse 37, Kashi Sanskrit Series No.220, PDF p.61 (main-text printed page 30), read from a clean 600dpi full-page render, text large and legible. Closes the shesha-bhava-sandhi-sadhana section (verses 36-37). Independently corroborated by the page's own Hindi commentary ("purvaapar bhaavon ke yogaardh ko sandhi kehte hain... is prakaar aagat lagnaadi 6 bhaav tathaa 6 sandhiyon mein 6 raashiyon ke jodne par anya sabhi bhaav tathaa sandhiyaan ho jaayenge") and by the page's own extended worked example, which computes the 2nd and 3rd houses (and, on the following page, the 5th/6th houses and the sandhis) by exactly this trisection-and-addition procedure. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भाव-होरा-घटी-लग्न साधन— अथ वक्ष्यामि ते भावलग्नादीनि द्विजोत्तम ! । यज्ज्ञानतः फलादेशे क्षमा होराविदो जनाः ॥ ३८ ॥

atha vakshyaami te bhaavalagnaadiini dvijottama | yajjnaanatah phalaadeshe kshamaa horaavido janaah || 38 ||

अंग्रेज़ी अर्थ

[Heading: "Computing the Bhava-lagna, Hora-lagna, and Ghati-lagna".] Now I shall tell you, O best of the twice-born (dvijottama), the Bhava-lagna and the other [two: Hora-lagna and Ghati-lagna] -- by knowledge of which, people (janah) versed in Hora (hora-vidah) become capable/competent (kshamah) in fruit-prediction (phaladesha).

हिन्दी अर्थ

[शीर्षक: "भाव-लग्न, होरा-लग्न, तथा घटी-लग्न का साधन"।] हे द्विजोत्तम, अब मैं तुम्हें भावलग्न आदि (भावलग्न, होरालग्न, घटीलग्न) बतलाता हूँ, जिनके ज्ञान से होराशास्त्र (ज्योतिष) के जानकार लोग फलादेश (फल बताने) में समर्थ होते हैं।

स्रोत: BPHS Ch.4, verse 38, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.63 (main-text printed page 32), read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p63-v38-43.png) confirming the printed text letter-by-letter. Opens the bhava-hora-ghati-lagna-sadhana (computation of three special lagnas) section under that explicit heading. Independently corroborated by the page's own Hindi commentary ("he Maitreya! ab main bhaavalagna-aadi bataataa huun. in bhaavalagna aadi ke jaankaar horaashaastragya phalaadesh mein nipun hote hain"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सूर्योदयात् पञ्चवाणदलैकघटिकामिताः । भावहोराघटीलग्नमितयः क्रमशो द्विज ! ॥ ३९ ॥

suuryodayaat panchavaaNadalaikaghatikaamitaah | bhaavahoraaghatiilagnamitayah kramasho dvija || 39 ||

अंग्रेज़ी अर्थ

From sunrise (suryodayat), [the sign-by-sign advance of the Bhava-lagna, Hora-lagna, and Ghati-lagna is] measured (mitah) [respectively] in units of five (pancha), half-of-vana [DISCLOSED: 'vaaNadala', literally 'half of vana/five (a bhuta-sankhya word-numeral for the five arrows of Kama)', i.e. two-and-a-half], and one (eka) ghatikas -- [these being] the measures (mitayah) of the Bhava-, Hora-, and Ghati-lagna, respectively (kramashah), O twice-born (dvija).

हिन्दी अर्थ

सूर्योदय से भावलग्न, होरालग्न, तथा घटीलग्न क्रमशः पाँच, ["वाणदल" अर्थात् पाँच का आधा, ढाई], तथा एक घटी के मान से [एक-एक राशि] व्यतीत होते हैं, हे द्विज।

स्रोत: BPHS Ch.4, verse 39, Kashi Sanskrit Series No.220, PDF p.63 (main-text printed page 32), read from a clean 600dpi full-page render and a further direct band-crop zoom, text legible at the letter level; the bhuta-sankhya compound "panchavaaNadalaika" (five, half-of-five, one) is disclosed as decoded via the standard vana=5 (arrows of Kama) convention rather than independently re-derived from a dictionary. Independently and precisely corroborated by the page's own Hindi commentary, which states the exact same three numeric rates explicitly: "suuryoday se bhaavalagna, horaalagna, ghatiilagna kramashah 5, 2.5, 1 ghatii pramaan se vyatiit hote hain". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

इष्टनाडीपले पञ्चहृते राश्यादिकं फलम् । यत्तदौदयिके सूर्ये योज्यमङ्कं तु भावजम् ॥ ४० ॥

ishtanaadiipale panchahrite raashyaadikam phalam | yattadaudayike suurye yojyamankam tu bhaavajam || 40 ||

अंग्रेज़ी अर्थ

When the ishta-nadi-palas (desired time, in ghati-palas) is divided by five, a sign-etc. (rashy-adikam) quotient (phalam) results. That figure (ankam), when added (yojyam) to the audayika (tropical/sayana, "risen") Sun, is the Bhava-[lagna] product (bhava-jam).

हिन्दी अर्थ

इष्ट नाड़ी-पल (इष्टकाल) को पाँच से भाग देने पर राश्यादि लब्धि (फल) प्राप्त होती है। उस अंक को औदयिक (सायन) सूर्य में जोड़ देने पर भावलग्न प्राप्त होता है।

स्रोत: BPHS Ch.4, verse 40, Kashi Sanskrit Series No.220, PDF p.63 (main-text printed page 32), read from a clean 600dpi full-page render, text large and legible. Independently corroborated by the page's own Hindi commentary ("isht kaal mein bhaavalagna saadhan ke liye ishtnaadii pal ko 5 se bhaag lene par jo raashyaadik labdhi hove use audayik suurya mein jod den to bhaavalagna ho jaayegaa"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एवमेते पुनर्द्वाभ्यां संगुण्य विभजेच्छरैः । लब्धं राश्यादिकं यत्तद्योज्यमौदयिके रवौ ॥ ४१ ॥

evamete punardvaabhyaam samgunya vibhajechchharaih | labdham raashyaadikam yattadyojyamaudayike ravau || 41 ||

अंग्रेज़ी अर्थ

Thus (evam), these same [ishta-nadi-palas], again multiplied by two (dvabhyam) and divided by 'shara' [a bhuta-sankhya word-numeral here denoting five, the arrows of Kama] -- whatever sign-etc. (rashy-adikam) quotient (labdham) is obtained, that too should be added (yojyam) to the audayika (tropical) Sun (ravau).

हिन्दी अर्थ

इसी प्रकार इन्हीं (इष्ट नाड़ी-पलों) को पुनः दो से गुणा कर पाँच ("शर", कामदेव के बाण) से भाग देने पर जो राश्यादि लब्धि प्राप्त हो, उसे भी औदयिक सूर्य में जोड़ देना चाहिए।

स्रोत: BPHS Ch.4, verse 41, Kashi Sanskrit Series No.220, PDF p.63 (main-text printed page 32), read from a clean 600dpi full-page render, text large and legible; "sharaih" (by the arrows) is the standard bhuta-sankhya term for five, matching "vaaNa" used similarly at verse 39. Independently corroborated by the page's own Hindi commentary ("isii tarah ishtaghatii palon ko do se gun kar paanch se bhaag len, raashyaadik labdhi ko audayik suurya mein jod den to sphut horaalagna ho jaayegaa"), which explicitly names the result Hora-lagna (this verse itself does not name the result, leaving that to verse 42). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

होरालग्नं स्फुटं तत् स्याद् घटीलग्नमथोच्यते । इष्टनाडीमितान् राशीनर्कैः सन्तष्टितांस्तथा ॥ ४२ ॥

horaalagnam sphutam tat syaad ghatiilagnamathochyate | ishtanaadiimitaan raashiinarkaih santashtitaamstathaa || 42 ||

अंग्रेज़ी अर्थ

That [result of verse 41] is the exact (sphuta) Hora-lagna. Now the Ghati-lagna is explained (athochyate): [DISCLOSED: the second line's precise word-segmentation is not confidently resolved letter-by-word here, but its computational sense -- as confirmed by the page's own commentary -- is that] the signs (rashin) numerically equal to (mitan) the ishta-nadi[-palas], reduced by twelve ('arkaih', a bhuta-sankhya word-numeral for the Sun/twelve Adityas, i.e. taken modulo twelve) as needed, are likewise (tatha) [added to the audayika Sun's own sign, continuing into verse 43].

हिन्दी अर्थ

वह (श्लोक ४१ का परिणाम) स्पष्ट होरालग्न होता है। अब घटीलग्न कहा जाता है: [स्पष्टीकरण: दूसरी पंक्ति का ठीक-ठीक शब्द-विभाजन यहाँ शब्दशः पूर्ण निश्चय के साथ नहीं किया जा सका है, परन्तु इसका गणितीय अभिप्राय -- जैसा कि पृष्ठ की अपनी टीका पुष्ट करती है -- यह है कि] इष्ट-नाड़ी (पलों) के तुल्य राशियों को बारह ('अर्कैः', सूर्य/बारह आदित्यों का भूतसंख्या-सूचक पद, अर्थात् आवश्यकतानुसार बारह से तष्टित/शुद्ध) से घटाकर, इसी प्रकार (तथा) [औदयिक सूर्य की अपनी राशि में जोड़ी जाती हैं, आगे श्लोक ४३ में जारी]।

स्रोत: BPHS Ch.4, verse 42, Kashi Sanskrit Series No.220, PDF p.63 (main-text printed page 32), read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p63-v42-43.png); the individual aksaras of the second line are legible, but the compressed technical term "santashtitaam" is DISCLOSED as not confidently parsed word-for-word on its own. The overall computational sense (audayika Sun's sign, plus signs equal in count to the ishta-ghatis, reduced modulo twelve) is independently and explicitly corroborated by the page's own Hindi commentary ("ghatiilagn saadhan ke liye audayik suurya ke raashi mein 12 se tadit ishtaghatii tulya raashiyon ko... suurya ke ansh mein jod den, phir jo raashyaadik hon [12 raashiyon se adhik hone par punah tadit kar den] vahi ghatiilagna hoga"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तत्पलार्धमितानंशानुदयार्के तु योजयेत् । भादिकं तदिदं बोध्यं घटीलग्नं सदा बुधैः ॥ ४३ ॥

tatpalaardhamitaanamshaanudayaarke tu yojayet | bhaadikam tadidam bodhyam ghatiilagnam sadaa budhaih || 43 ||

अंग्रेज़ी अर्थ

And [continuing from verse 42, one] should add (yojayet) to the udaya[dika, tropical]-Sun's degrees, degrees (amshan) numerically equal to (mitan) half the ishta-palas (tat-pala-ardha). This sign-degree (bhaadikam) result should always be understood (bodhyam) by the wise (budhaih) as the Ghati-lagna.

हिन्दी अर्थ

तथा उदयार्क (औदयिक सूर्य) के अंश में इष्ट-पलों के आधे के तुल्य अंश जोड़ देने चाहिए। इस राश्यंशादि परिणाम को विद्वानों को सदैव घटीलग्न समझना चाहिए।

स्रोत: BPHS Ch.4, verse 43, Kashi Sanskrit Series No.220, PDF p.63 (main-text printed page 32), read from a clean 600dpi full-page render and a further direct band-crop zoom, text large and legible. Closes the six-verse (38-43) bhava-hora-ghati-lagna-sadhana section, explicitly cited by the page's own commentary as a combined unit ("...vahii ghatiilagn hogaa || 38-43 ||") and worked through in a following numerical example (beginning on this same page: "ishtaghatii 25.15 mein paanch se bhaag dene par labdhi = 5.3.0.10", computing all three lagnas), which independently confirms the amsha-addition rule stated here. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पूर्णं फलं ग्रहे भावसमे शून्यं तु सन्धिगे । सन्धिद्वयान्तरगते भवेत्तद्द्वावजं फलम् ॥ ४४ ॥

puurnam phalam grahe bhaavasame shuunyam tu sandhige | sandhidvayaantaragate bhavettaddvaavajam phalam || 44 ||

अंग्रेज़ी अर्थ

Full (purnam) result (phalam) [comes] when a planet (grahe) is exactly at (same degree as) the Bhava(-lagna) (bhava-same); zero (shunyam), however, when at a sandhi (cusp) (sandhi-ge). When [a planet is] positioned between two sandhis (sandhi-dvaya-antara-gate), the result belonging to (jam) that [bhava] between the two (tad-dvau) should apply.

हिन्दी अर्थ

जब ग्रह भावलग्न के बराबर अंश पर हो, तब पूर्ण फल होता है; और सन्धि (कस्प) पर होने पर शून्य फल होता है। यदि ग्रह दो सन्धियों के बीच में स्थित हो, तो उन दोनों के मध्यवर्ती भाव का ही फल प्राप्त होता है।

स्रोत: BPHS Ch.4, verse 44, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.65 (main-text printed page 43), read from a clean 600dpi full-page render, text large and legible. Opens the closing bhava-phala (result-by-bhava-position) rule of the chapter, immediately following the bhava-hora-ghati-lagna worked example. Independently corroborated by the page's own Hindi commentary ("bhaavtulya grah mein us bhaav ka poorn phal aur sandhitulya grah mein shoonya phal hota hai. donon sandhiyon ke madhya mein kahin bhi grah rahe to unhi donon sandhiyon ke biich vaale bhaav ka phal vah detaa hai"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सन्धिभ्यामधिके न्यूने फलमग्रिमपूर्वजम् । भावलग्नातु तिथ्यंशैः पुरः पृष्ठगतैर्द्विज ॥ ४५ ॥ फलाभाव-फलारम्भौ सन्धीचापि विनिर्दिशेत् ।

sandhibhyaamadhike nyuune phalamagrimapuurvajam | bhaavalagnaatu tithyamshaih purah prishthagatairdvija || 45 || phalaabhaava-phalaarambhau sandhiichaapi vinirdishet |

अंग्रेज़ी अर्थ

When [a planet's degree is] more or less (adhike nyune) than [the degrees of] the [two flanking] sandhis, the result is that born of the following or the preceding [bhava] (agrima-purva-jam) [respectively]. From the Bhava-lagna, O twice-born (dvija), by degrees numbering fifteen (tithy-amshaih) [DISCLOSED: 'tithi' is a standard bhuta-sankhya word-numeral for fifteen, the lunar tithis of a paksha] going forward (purah) and going backward (prishtha-gataih) -- these should be designated (vinirdishet) as, respectively, the phala-abhava (result-ending) and phala-arambha (result-beginning) sandhis.

हिन्दी अर्थ

सन्धियों से अधिक या न्यून होने पर क्रमशः अगले या पिछले भाव का फल होता है। हे द्विज, भावलग्न से तिथि-तुल्य (पन्द्रह) अंश आगे तथा पन्द्रह अंश पीछे के स्थानों को ही क्रमशः फलाभाव (फल-समाप्ति) तथा फलारम्भ (फल-प्रारम्भ) की सन्धियाँ जानना चाहिए।

स्रोत: BPHS Ch.4, verse 45 (three-line unit: numbered after line 2, with an unnumbered continuation line 3, consistent with the convention already used at verses 9, 19, 31, and 32 of this chapter), Kashi Sanskrit Series No.220, PDF p.65 (main-text printed page 43), read from a clean 600dpi full-page render, text large and legible. "tithy-amshaih" (fifteen degrees) is disclosed as decoded via the standard tithi=15 bhuta-sankhya convention. Closes the two-verse (44-45) bhava-phala rule, explicitly cited by the page's own commentary as "॥४४-४५॥", and precisely corroborated ("bhaavalagnon se 15 ansh aage aur 15 ansh peechhe kramashah phalaabhaav tathaa phalaarambh ke sthaan tathaa donon sandhiyaan hoti hain"). This verse closes Chapter 4 (grahaadi-sadhanaadhyaya, 'the chapter on computing the planets/lagnas and related items'); the page continues with a lengthy editorial 'vimarsha' (discussion) paragraph by the modern commentator weighing the bhava-lagna method against the sandhi method, followed by the chapter's closing colophon ("iti savimarsha-sudhaakhyaakhyopetaayaam brihatpaaraashara-horaayaam grahaadisaadhanaadhyaayah samaaptah || 4 ||") -- both are editorial/colophon material, not root verses, and are correctly excluded from transcription per this project's copyright-safety discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ राशिशीलाध्यायः ॥ ५ ॥ अहोरात्र-पदाद्यन्त्यलोपाद्धोरेति कथ्यते । तस्या हि ज्ञानमात्रेण जातकर्मफलं वदेत् ॥ १ ॥

atha raashishiilaadhyaayah || 5 || ahoraatra-padaadyantyalopaaddhoreti kathyate | tasyaa hi jnaanamaatreNa jaatakarmaphalam vadet || 1 ||

अंग्रेज़ी अर्थ

[Chapter 5: "The Chapter on the Nature of the Signs" (Rashi-shila-adhyaya).] By the elision (lopa) of the first and last syllables of the word 'ahoratra' (day-and-night), it is called (kathyate) 'hora'. By mere knowledge (jnaana-maatreNa) of it [the hora/lagna], indeed (hi), one should declare (vadet) the native's (jaataka) karma-phala (the fruits of past action, i.e. life-events).

हिन्दी अर्थ

[अध्याय ५: "राशिशीलाध्यायः" (राशियों के स्वभाव का अध्याय)।] 'अहोरात्र' पद के आदि तथा अन्त्य वर्ण का लोप होने से 'होरा' कहलाती है। इस होरा (लग्न) के ज्ञानमात्र से ही जातक का कर्मफल (शुभाशुभ फल) कहना चाहिए।

स्रोत: BPHS, Chapter 5 (Rashi-shila-adhyaya, "the chapter on the nature of the signs"), verse 1, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.66 (main-text printed page 45), read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p66-v1-3.png) confirming the printed text letter-by-letter. Opens Chapter 5 immediately after Chapter 4's closing colophon. Independently corroborated by the page's own Hindi commentary ("'ahoraatra' is pad ke aadim evam antim varn lop se 'hora' ki nishpatti hoti hai. is hora (lagna) ke gyaanmaatra se jaatak ka karmaphal (shubhaashubhaphal) kehna chahiye"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यदव्यक्तात्मको विष्णुः कालरूपो जनार्दनः । तस्याङ्गानि निबोध त्वं क्रमान्मेषादिराशयः ॥ २ ॥

yadavyaktaatmako vishnuh kaalaruupo janaardanah | tasyaangaani nibodha tvam kramaanmeshaadiraashayah || 2 ||

अंग्रेज़ी अर्थ

That Vishnu, whose essence is unmanifest (avyakta-aatmakah), Janardana in the form of Time (kaala-rupah) -- know (nibodha) you (tvam) his limbs (tasya angaani) to be, in order (kramaat), the signs beginning with Mesha (Aries).

हिन्दी अर्थ

जो अव्यक्तस्वरूप विष्णु, कालरूप जनार्दन हैं -- हे (शिष्य), उन्हीं के अंग क्रमशः मेषादि राशियाँ हैं, ऐसा जानो।

स्रोत: BPHS Ch.5, verse 2, Kashi Sanskrit Series No.220, PDF p.66 (main-text printed page 45), read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p66-v2-word.png) confirming the compressed word "tasyaangaani" (his limbs). Independently corroborated by the page's own Hindi commentary ("kaal svaruup jo avyaktaatmaa, janaardan, vishnu hain unhiin ke ang meshaadi 12 raashiyaan hain, aisa samajho"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मेषो वृषश्च मिथुनः कर्क-सिंह-कुमारिकाः । तुलालिचापमकराः कुम्भमीनौ यथाक्रमम् ॥ ३ ॥

mesho vrishashcha mithunah karka-simha-kumaarikaah | tulaalichaapamakaraah kumbhamiinau yathaakramam || 3 ||

अंग्रेज़ी अर्थ

Mesha (Aries) and Vrisha (Taurus) and Mithuna (Gemini), Karka (Cancer), Simha (Leo), Kumarika (Virgo), Tula (Libra), Ali (Scorpio), Chapa (Sagittarius), Makara (Capricorn), Kumbha (Aquarius) and Mina (Pisces) -- in due order (yathaakramam) [are the twelve signs, the limbs of Kalapurusha named in verse 2].

हिन्दी अर्थ

मेष, वृष, मिथुन, कर्क, सिंह, कन्या (कुमारिका), तुला, वृश्चिक (अलि), धनु (चाप), मकर, कुम्भ, तथा मीन -- ये यथाक्रम (क्रमशः) [काल-पुरुष के बारह अंग, अर्थात् बारह राशियाँ हैं]।

स्रोत: BPHS Ch.5, verse 3, Kashi Sanskrit Series No.220, PDF p.66 (main-text printed page 45), read from a clean 600dpi full-page render and a further direct band-crop zoom, text large and legible. Closes the three-verse (1-3) opening unit, explicitly cited by the page's own commentary as "॥१-३॥". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

काल पुरुष के अङ्ग-विभाग— शीर्षानने तथा बाहू हृत्कोष्ठकटिवस्तयः । गुह्योरुयुगले जानुयुग्मे वै जङ्घे तथा ॥ ४ ॥ चरणौ द्वौ तथाऽजादेर्ज्ञेयाः शीर्षादयः क्रमात् ।

shiirshaanane tathaa baahuu hritkoshthakativastayah | guhyoruyugale jaanuyugme vai janghe tathaa || 4 || charaNau dvau tathaa'jaaderjneyaah shiirshaadayah kramaat |

अंग्रेज़ी अर्थ

[Heading: "The limb-division of Kalapurusha (the Time-Purusha)".] The head and the face (shirsha-anane); and the two arms (bahu); the heart, the belly, the waist, and the bladder (hrit-koshtha-kati-vasti); the genitals and the pair of thighs (guhya-uru-yugale); the pair of knees (janu-yugme); and likewise the two shanks (janghe); and the two feet (charanau dvau) as well -- these, beginning from the head (shirsha-adayah), should be known in order (kramaat) starting from Aja [Mesha/Aries onward, i.e. mapped one each to the twelve signs of verse 3].

हिन्दी अर्थ

[शीर्षक: "काल-पुरुष के अंग-विभाग"।] शिर तथा मुख; दोनों भुजाएँ; हृदय, उदर, कटि, तथा वस्ति (मूत्राशय); गुह्य (गुप्तांग) तथा दोनों जाँघें; दोनों घुटने; तथा दोनों पिंडलियाँ (जंघा); तथा दोनों पैर भी -- ये [बारह अंग], शिर से आरम्भ कर, मेष (अज) आदि राशियों में क्रमशः जानने चाहिए।

स्रोत: BPHS Ch.5, verse 4, Kashi Sanskrit Series No.220, PDF p.66 (main-text printed page 45), read from a clean 600dpi full-page render and TWO further direct band-crop zooms (scratchpad/bphs-p66-v4.png and scratchpad/bphs-p66-v4-word.png), the second specifically confirming the compressed compound "hritkoshthakativastayah" (heart-belly-waist-bladder) letter-by-letter, correcting an initial less-certain overview reading of that compound. The heading, the two-line numbered verse, and its unnumbered continuation third line are transcribed together as one unit, consistent with the convention already used repeatedly in Chapter 4 (e.g. verses 9, 19, 31, 32, 45). This is the standard twelve-fold Kalapurusha body-map (Mesha=head, Vrishabha=face, Mithuna=arms, Karka=heart, Simha=belly, Kanya=waist, Tula=bladder, Vrishchika=genitals, Dhanu=thighs, Makara=knees, Kumbha=shanks, Mina=feet), independently corroborated by the page's own Hindi commentary, which restates the same twelve items (with 'guhya' expanded there as 'ling, guda' -- genitals and anus together, still one item for Vrishchika) and closes with "...baarah ang kramashah meshaadi dvaadash raashiyaan hain || 4 ||". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राशियों की चरादि संज्ञा— चरस्थिरद्विस्वभावाः क्रूराक्रूरौ नरस्त्रियौ ॥ ५ ॥ पित्तानिलत्रिधात्वैक्य-श्लैष्मिकाश्च क्रियादयः ।

charasthiradvisvabhaavaah kruuraakruurau narastriyau || 5 || pittaanilatridhaatvaikya-shlaishmikaashcha kriyaadayah |

अंग्रेज़ी अर्थ

[Heading: "The chara (movable) etc. designations of the signs".] [The twelve signs] beginning with Kriya (Mesha/Aries) [onward] are, [respectively, in repeating groups of three]: movable, fixed, and dual-natured (chara-sthira-dvi-svabhaavaah); cruel and gentle (kruura-akruurau); male and female (nara-striyau); and of bilious (pitta), windy (anila), of-united-three-humors (tri-dhaatu-aikya), and phlegmatic (shlaishmika) nature.

हिन्दी अर्थ

[शीर्षक: "राशियों की चर आदि संज्ञा"।] क्रिया (मेष) आदि राशियाँ [क्रमशः, तीन-तीन के समूह में] चर, स्थिर, तथा द्विस्वभाव कही जाती हैं; क्रूर तथा अक्रूर (सौम्य); नर तथा स्त्री (संज्ञक); तथा पित्त, वात (अनिल), त्रिधातु (सन्निपात), एवं कफ प्रकृति वाली होती हैं।

स्रोत: BPHS Ch.5, verse 5 (heading + numbered first line + unnumbered continuation second line, consistent with the recurring multi-line-unit convention), Kashi Sanskrit Series No.220, PDF p.66 (main-text printed page 45), read from a clean 600dpi full-page render and two further direct band-crop zooms (scratchpad/bphs-p66-v5-real3.png and scratchpad/bphs-p66-v5-line2c.png) confirming both lines letter-by-letter, including the compressed compound "pittaanilatridhaatvaikya-shlaishmikaashcha". Independently and precisely corroborated by the page's own following Hindi commentary, which explicitly enumerates the resulting sign-groups (chara: Mesha/Karka/Tula/Makara; sthira: Vrisha/Simha/Vrishchika/Kumbha; dvisvabhava: Mithuna/Kanya/Dhanu/Mina; odd/krura signs: Mesha/Mithuna/Simha/Tula/Dhanu/Kumbha as male; even/gentle signs as female; pitta-prakritika: Mesha/Simha/Dhanu; vata-prakritika: Vrisha/Kanya/Makara; tridhatu-prakritika: Mithuna/Tula/Kumbha; kapha-prakritika: Karka/Vrishchika/Mina). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रक्तवर्णो वृहद्गात्रश्चतुष्पाद् रात्रिविक्रमी ॥ ६ ॥

raktavarNo vrihadgaatrashchatushpaad raatrivikramii || 6 ||

अंग्रेज़ी अर्थ

[Mesha (Aries) is] red-colored (rakta-varnah), large-bodied (vrihad-gatrah), four-footed (chatushpat), of night-prowess (raatri-vikramii) --

हिन्दी अर्थ

[मेष राशि] रक्त वर्ण की, बड़े शरीर वाली, चार पैरों वाली, तथा रात्रि में पराक्रमी (बलवान्) है --

स्रोत: BPHS Ch.5, verse 6, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.67, read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p67-v6-7.png) confirming the printed text letter-by-letter. Opens the per-sign description section (following the general classifications of verses 3-5), beginning with Mesha. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पूर्ववासी नृपज्ञातिः शैलचारी रजोगुणी । पृष्ठोदयी पावकी च मेषराशिः कुजाधिपः ॥ ७ ॥

puurvavaasii nripajnaatih shailachaarii rajoguNii | prishthodayii paavakii cha mesharaashih kujaadhipah || 7 ||

अंग्रेज़ी अर्थ

[Continuing from verse 6:] dwelling in the east (purva-vasi), of royal kinship (nripa-jnatih, i.e. of Kshatriya caste), a mountain-wanderer (shaila-chari), of rajo-guna; rising by the back (prishtha-udayii), and fiery (pavaki, i.e. of the fire element) -- [thus is] the Mesha (Aries) sign, whose lord is Kuja (Mars, kuja-adhipah).

हिन्दी अर्थ

[श्लोक ६ से आगे:] पूर्व दिशा में निवास करने वाली, राजा के समान जाति (क्षत्रिय) वाली, पर्वतों में विचरण करने वाली, रजोगुणी; पीठ से उदय होने वाली, तथा अग्नितत्त्व वाली -- यह मेष राशि है, जिसका स्वामी कुज (मंगल) है।

स्रोत: BPHS Ch.5, verse 7, Kashi Sanskrit Series No.220, PDF p.67, read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p67-v6-7.png and bphs-p67-v7-line2.png) confirming the printed text letter-by-letter. Closes the Mesha description (verses 6-7). Independently corroborated by the page's own Hindi commentary describing Mesha's colour, size, footedness, night-strength, easterly direction, Kshatriya caste, mountain-terrain, rajo-guna, back-rising, fiery nature, and rulership by Mangal (Mars). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

श्वेतः शुक्राधिपो दीर्घश्चतुष्पाच्छर्वरीबली । याम्येट् ग्राम्यो वणिग् भूमी रजः पृष्ठोदयो वृषः ॥ ८ ॥

shvetah shukraadhipo diirghashchatushpaachcharvariibalii | yaamyeT graamyo vaNig bhuumii rajah prishthodayo vrishah || 8 ||

अंग्रेज़ी अर्थ

White (shvetah), ruled by Shukra (Venus, shukra-adhipah), long-bodied (dirghah), four-footed, of night-strength (sharvari-balii); [DISCLOSED: the printed text here reads "yaamyeT", an anomalous form that does not parse as standard Sanskrit as printed -- based on the metrical expectation and the page's own Hindi commentary, which explicitly states Vrishabha dwells "yaamya disha mein" (in the south direction), this is read as intending "yaamye" (in the south)] village-dwelling (graamyah), a merchant [Vaishya] (vaNik), earthy (bhuumii), of rajo-guna, rising by the back (prishtha-udayah) -- [thus is] Vrisha (Taurus).

हिन्दी अर्थ

श्वेत वर्ण की, शुक्र द्वारा शासित, लम्बे शरीर वाली, चार पैरों वाली, रात्रि में बलवान्; [स्पष्टीकरण: मुद्रित पाठ में यहाँ "याम्येट्" शब्द है, जो मानक संस्कृत रूप में स्पष्ट अर्थ नहीं देता -- छन्द की अपेक्षा तथा पृष्ठ की अपनी हिन्दी टीका (जिसमें स्पष्ट रूप से "याम्य दिशा में निवास" अर्थात् दक्षिण दिशा में निवास कहा गया है) के आधार पर इसका अभिप्राय "याम्ये" (दक्षिण दिशा में) समझा गया है], ग्राम में निवास करने वाली, वणिक् (वैश्य) जाति की, भूमितत्त्व (पृथ्वीतत्त्व) वाली, रजोगुणी, पीठ से उदय होने वाली -- यह वृष (वृषभ) राशि है।

स्रोत: BPHS Ch.5, verse 8, Kashi Sanskrit Series No.220, PDF p.67, read from a clean 600dpi full-page render and further direct zoom crops (scratchpad/bphs-p67-v8.png, bphs-p67-v8-line2-wide.png, bphs-p67-v8-word2.png, bphs-p67-v8-word3.png, bphs-p67-v8-word4.png) taken specifically to resolve the anomalous opening word of line 2, printed clearly and repeatably as "yaamyeT" across multiple independent crops -- this is disclosed rather than silently corrected, since the zoom confirmed the anomalous glyphs are indeed what is printed, though the intended sense (dwelling in the south) is strongly corroborated by the page's own Hindi commentary. "prishthodayo" was independently zoom-confirmed at high magnification (bphs-p67-v8-word4.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शीर्षोदयी नृमिथुनं सगदं च सवीणकम् । प्रत्यङ्मरुद् द्विपाद्रात्रिबली ग्रामव्रजोऽनिली ॥ ९ ॥

shiirshodayii nrimithunam sagadam cha saviiNakam | pratyanmarud dvipaadraatribalii graamavrajo'nilii || 9 ||

अंग्रेज़ी अर्थ

Rising by the head (shirsha-udayii); a human pair (nri-mithunam), with a mace (sa-gadam) and with a veena (sa-viinakam); facing west (pratyak), of the wind [element] (marut); two-footed (dvi-pad), of night-strength; wandering/dwelling in villages (grama-vrajah), and windy [in nature] (anilii) -- [thus is Mithuna].

हिन्दी अर्थ

सिर से उदय होने वाला; नर-युगल (मिथुन) रूप, गदा सहित तथा वीणा सहित; पश्चिम दिशा की ओर, वायुतत्त्व वाला; दो पैरों वाला, रात्रि में बलवान्; ग्रामों में विचरण करने वाला, तथा वायु-स्वभाव वाला -- यह मिथुन राशि है।

स्रोत: BPHS Ch.5, verse 9, Kashi Sanskrit Series No.220, PDF p.67, read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p67-v9.png) confirming the printed text letter-by-letter, including the sandhi-joined "graamavrajo'nilii" (graama-vrajah + anilii). Independently corroborated by the page's own Hindi commentary describing Mithuna as a human pair holding a mace and veena, facing west, of the wind element, two-footed, night-strong, village-dwelling, and windy in nature. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पाटलो वनचारी च ब्राह्मणो निशि वीर्यवान् ॥ १० ॥

paatalo vanachaarii cha braahmaNo nishi viiryavaan || 10 ||

अंग्रेज़ी अर्थ

Pink/pale-red (paatalah), forest-wandering (vana-chari), and of Brahmin [caste] (brahmanah), potent at night (nishi viryavaan) --

हिन्दी अर्थ

पाटल (गुलाबी/हल्के लाल) वर्ण का, वन में विचरण करने वाला, तथा ब्राह्मण जाति का, रात्रि में बलवान् --

स्रोत: BPHS Ch.5, verse 10 (first of the two-verse 10-11 unit for Karka, explicitly closed by the page's own combined citation "॥१०-११॥"), Kashi Sanskrit Series No.220, PDF p.67, read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p67-v10-11.png) confirming the printed text letter-by-letter. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

बहुपादी स्थूलतनुस्तथा सत्त्वगुणी जली । पृष्ठोदयी कर्कराशिर्मृगाङ्काधिपतिः स्मृतः ॥ ११ ॥

bahupaadii sthuulatanustathaa sattvaguNii jalii | prishthodayii karkaraashirmrigaankaadhipatih smritah || 11 ||

अंग्रेज़ी अर्थ

[Continuing from verse 10:] many-footed (bahu-padi), thick-bodied (sthula-tanuh), and of sattva-guna, watery [in element] (jalii); rising by the back (prishtha-udayii) -- the Karka (Cancer) sign is remembered (smritah) as ruled by Mriganka ("the deer-marked", i.e. the Moon, mriganka-adhipatih).

हिन्दी अर्थ

[श्लोक १० से आगे:] बहुत पैरों वाली, स्थूल (मोटे) शरीर वाली, तथा सत्त्वगुणी, जलतत्त्व वाली; पीठ से उदय होने वाली -- यह कर्क राशि मृगाङ्क (चन्द्रमा) द्वारा शासित मानी गई है।

स्रोत: BPHS Ch.5, verse 11, Kashi Sanskrit Series No.220, PDF p.67, read from a clean 600dpi full-page render and further direct zoom crops (scratchpad/bphs-p67-v10-11.png and bphs-p67-v11-line3.png) confirming the closing line letter-by-letter, including the combined citation "॥१०-११॥" that follows it. Closes the two-verse (10-11) Karka description. Independently corroborated by the page's own Hindi commentary describing Karka's pink colour, forest-terrain, Brahmin caste, night-strength, many feet, thick body, sattva-guna, watery element, back-rising, and rulership by the Moon (Mriganka). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सिंहः सूर्याधिपः सत्त्वी चतुष्पात् क्षत्रियो वनी । शीर्षोदयी वृहद्गात्रः पाण्डुः पूर्वेड् घ्रुवीर्यंवान् ॥ १२ ॥

simhah suuryaadhipah sattvii chatushpaat kshatriyo vanii | shiirshodayii vrihadgaatrah paaNDuh puurveD ghruviiryamvaan || 12 ||

अंग्रेज़ी अर्थ

The Simha (Lion, i.e. Leo) [sign] is ruled by Surya (the Sun, surya-adhipah), of sattva-guna, four-footed, of Kshatriya [caste], forest-dwelling (vanii); rising by the head (shirsha-udayii), large-bodied (vrihad-gatrah), pale-colored (paaNDuh); [DISCLOSED: the printed text here reads "puurveD ghruviiryamvaan", an anomalous compressed form that does not parse cleanly as standard Sanskrit as printed -- based on the page's own Hindi commentary, which explicitly glosses this portion as "purva-disha mein nivaas, tathaa din mein bal hota hai" (dwelling in the east direction, and possessing strength by day), this is read as intending "purve" (in the east) and a form meaning "diva-viryavaan" (potent by day)].

हिन्दी अर्थ

सिंह राशि सूर्य द्वारा शासित, सत्त्वगुणी, चतुष्पद, क्षत्रिय जाति की, वनचारी है; सिर से उदय होने वाली, बड़े शरीर वाली, पाण्डु (पीले-श्वेत) वर्ण वाली है; [स्पष्टीकरण: मुद्रित पाठ में यहाँ असामान्य संक्षिप्त रूप "पूर्वेड् घ्रुवीर्यंवान्" है, जो मानक संस्कृत रूप में स्पष्ट अर्थ नहीं देता -- पृष्ठ की अपनी हिन्दी टीका ("पूर्व दिशा में निवास, तथा दिन में बल होता है") के आधार पर इसका अभिप्राय पूर्व दिशा में निवास तथा दिन में बलवान् होना समझा गया है]।

स्रोत: BPHS Ch.5, verse 12, Kashi Sanskrit Series No.220, PDF p.67, read from a clean 600dpi full-page render and further direct zoom crops (scratchpad/bphs-p67-v12-word.png, bphs-p67-v12-word3.png) taken specifically to resolve the anomalous closing words of line 2, printed clearly and repeatably as "puurveD ghruviiryamvaan" -- this is disclosed rather than silently corrected, since the zoom confirmed the anomalous glyphs are indeed what is printed, though the intended sense (east-dwelling, day-potent) is precisely corroborated word-for-word by the page's own Hindi commentary (scratchpad/bphs-p67-v13.png, upper portion: "shiirsh se uday, badaa shariir, paaNDuvarN, purvadishaa mein nivaas, tathaa din mein bal hotaa hai || 12 ||"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पार्वंतीयाथ कन्याख्या राशिर्दिनबलान्विता । शीर्षोदया च मध्याङ्गा द्विपाद्याम्यचरा च सा ॥ १३ ॥

paarvantiiyaatha kanyaakhyaa raashirdinabalaanvitaa | shiirshodayaa cha madhyaangaa dvipaadyaamyacharaa cha saa || 13 ||

अंग्रेज़ी अर्थ

Mountain-dwelling (parvatiiya) indeed is the sign named (akhya) Kanya (the Maiden, i.e. Virgo), endowed with day-strength (dina-balaanvitaa); rising by the head (shirsha-udayaa), of middling limbs (madhya-angaa), two-footed, and moving in the south (dvipaad-yaamya-charaa) is she (saa).

हिन्दी अर्थ

पर्वतीय प्रदेशों में विचरण करने वाली कन्या नामक राशि दिन में बलवती है; सिर से उदय होने वाली, मध्यम अंगों वाली, दो पैरों वाली, तथा दक्षिण दिशा में विचरण करने वाली है वह।

स्रोत: BPHS Ch.5, verse 13 (first of the two-verse 13-14 unit for Kanya, explicitly closed by the page's own combined citation "॥१३-१४॥"), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.67 (opening line read on the prior page) continuing onto PDF p.68, read from clean 600dpi full-page renders and a direct zoom crop (scratchpad/bphs-p67-v13.png) confirming the printed text letter-by-letter, including "paarvantiiyaatha" (mountain-dwelling, indeed), independently corroborated by the following page's own Hindi commentary opening "kanyaa raashi kaa parvatiiya pradeshon mein vicharaN..." (Kanya sign wanders in mountainous regions). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सा सस्यदहना वैश्या चित्रवर्णा प्रभञ्जिनी । कुमारी तमसा युक्ता वालभावा बुधाधिपा ॥ १४ ॥

saa sasyadahanaa vaishyaa chitravarNaa prabhanjinii | kumaarii tamasaa yuktaa vaalabhaavaa budhaadhipaa || 14 ||

अंग्रेज़ी अर्थ

She [Kanya] holds grain and fire [in hand] (sasya-dahanaa) [DISCLOSED: read per the page's own commentary, "sasya sahit agni ka haath mein dhaaran" -- grain together with fire held in hand], of Vaishya [caste], of variegated color (chitra-varNaa), windy [i.e. of the wind/vayu element] (prabhanjinii); a maiden (kumaarii), imbued with tamo-guna (tamasaa yuktaa), of youthful/childlike form (vaala-bhaavaa), ruled by Budha (Mercury, budha-adhipaa).

हिन्दी अर्थ

वह शस्य (अनाज) तथा अग्नि हाथ में धारण करने वाली, वैश्य जाति की, चित्रवर्णा, वायुस्वभावा है; कुमारी, तमोगुणी, बाल-अवस्था वाली, तथा बुध द्वारा शासित है।

स्रोत: BPHS Ch.5, verse 14, Kashi Sanskrit Series No.220, PDF p.68, read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p68-v14.png, bphs-p68-v14b.png) confirming the printed text letter-by-letter. Closes the two-verse (13-14) Kanya description, explicitly cited by the commentary as "॥१३-१४॥" and fully corroborated ("...saasya sahit agni ka haath mein dhaaran, vaishyajaati, chitravarN, vaayutatva, kumaar avasthaa, tamoguN tathaa svaamii budh hote hain"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शीर्षोदयी घुवीर्याढ्यो घटः कृष्णो रजोगुणी । पश्चिमो भूचरो घाती शूद्रो मध्यतनुर्द्विपात् ॥ १५ ॥

shiirshodayii ghuviiryaaDhyo ghaTah krishNo rajoguNii | pashchimo bhuucharo ghaatii shuudro madhyatanurdvipaat || 15 ||

अंग्रेज़ी अर्थ

Rising by the head (shirsha-udayii); [DISCLOSED: the printed text reads "ghuviiryaaDhyah", an anomalous compressed form paralleling the one already disclosed at verse 12 ("ghruviiryamvaan") -- based on the identical phrase printed correctly at verse 16 of this same page ("dinaviiryaaDhyah") and this page's own commentary here ("din mein prabalataa", strong by day), this is read as intending "dina-viiryaaDhyah", i.e. "endowed with day-strength"]; [DISCLOSED: the following word "ghaTah" is not explicitly glossed by the commentary and its precise intended sense here is unclear] black-colored (krishNah), of rajo-guna; western-dwelling (pashchimah), earth-wandering (bhuucharah), of a harmful/violent nature (ghaatii), of Shudra [caste], of middling body (madhya-tanuh), two-footed -- [thus is Tula (the Scale, Libra), per this page's heading "shukraadhiyo'tha" ("and now, ruled by Shukra") and its closing commentary].

हिन्दी अर्थ

सिर से उदय होने वाली; [स्पष्टीकरण: मुद्रित पाठ में "घुवीर्याढ्यः" शब्द है, जो श्लोक १२ में पहले से प्रकट हुए "घ्रुवीर्यंवान्" के समान ही असामान्य संक्षिप्त रूप है -- इसी पृष्ठ के श्लोक १६ में ठीक उसी अर्थ का शुद्ध मुद्रित रूप "दिनवीर्याढ्यः" है, तथा यहाँ की हिन्दी टीका भी "दिन में प्रबलता" कहती है, अतः इसका अभिप्राय "दिनवीर्याढ्यः" (दिन में बलवान्) समझा गया है]; [स्पष्टीकरण: आगे का शब्द "घटः" टीका में स्पष्ट नहीं किया गया है, इसका ठीक अभिप्राय अनिश्चित है] कृष्ण वर्ण की, रजोगुणी; पश्चिम दिशा में निवास करने वाली, भूमि में विचरण करने वाली, हिंसक प्रकृति की, शूद्र जाति की, मध्यम शरीर वाली, दो पैरों वाली है -- यह तुला राशि है, जिसका स्वामी शुक्र है।

स्रोत: BPHS Ch.5, verse 15, Kashi Sanskrit Series No.220, PDF p.68, read from a clean 600dpi full-page render and further direct zoom crops (scratchpad/bphs-p68-v15.png, bphs-p68-v15-word.png) taken specifically to resolve the anomalous "ghuviiryaaDhyo" and the unglossed "ghaTah", both confirmed as printed exactly this way across repeated crops. Followed by the subheading "shukraadhiyo'tha--" and closed individually with "॥ १५ ॥", corroborated by the page's own Hindi commentary ("tulaa raashi kaa shiirsh se uday, din mein prabalataa, krishNavarN, rajoguN, pashchim dishaa mein nivaas, bhuumi mein vicharaN, hinsak prakriti, shuudrajaati, madhyamashariir, do pair tathaa svaamii shukra hote hain || 15 ||"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वल्पाङ्गोऽबहुपाद्ब्राह्मणोऽविली । सौम्यस्थो दिनवीर्याढ्यः पिशङ्गो जलभूवहः ॥ १६ ॥ रोमस्वाढ्योऽतितीक्ष्णाग्रो वृश्चिकश्च कुजाधिपः ।

svalpaango'bahupaadbraahmaNo'vilii | saumyastho dinaviiryaaDhyah pishango jalabhuuvahah || 16 || romasvaaDhyo'titiikshNaagro vrishchikashcha kujaadhipah |

अंग्रेज़ी अर्थ

Small-bodied (svalpa-angah), many-footed (bahu-paat), of Brahmin [caste], [DISCLOSED: "avilii" is read, per the commentary's "bil mein sansthaan" (dwelling in a burrow/hole), as conveying burrow-dwelling]; situated in the north (saumya-sthah), endowed with day-strength (dina-viiryaaDhyah), tawny-colored (pishangah), water-and-earth-bearing (jala-bhuu-vahah, i.e. of the water element, moving on earth); [DISCLOSED: "romasvaaDhyah" is read, per the commentary's "roma-yukta shariir" (hair-covered body), as conveying a hairy body] of extremely sharp sting (ati-tiikshNa-agrah) -- and thus is Vrishchika (the Scorpion, Scorpio), ruled by Kuja (Mars, kuja-adhipah).

हिन्दी अर्थ

छोटे शरीर वाला, बहुत पैरों वाला, ब्राह्मण जाति का, [स्पष्टीकरण: "अविली" शब्द को टीका के "बिल में संस्थान" (बिल/गड्ढे में निवास) के आधार पर बिल-निवासी समझा गया है]; उत्तर दिशा में स्थित, दिन में बलवान्, पिशंग (हल्के भूरे-पीले) वर्ण का, जलतत्त्व सहित भूमि में विचरण करने वाला; [स्पष्टीकरण: "रोमस्वाढ्यः" शब्द को टीका के "रोमयुक्त शरीर" के आधार पर बालों से युक्त शरीर वाला समझा गया है], अत्यन्त तीक्ष्ण डंक वाला -- यह वृश्चिक राशि है, जिसका स्वामी कुज (मंगल) है।

स्रोत: BPHS Ch.5, verse 16 (three-line unit: numbered after line 2, with an unnumbered continuation line 3), Kashi Sanskrit Series No.220, PDF p.68, read from a clean 600dpi full-page render and further direct band-crop zooms (scratchpad/bphs-p68-v16.png, bphs-p68-v16c.png) confirming the printed text letter-by-letter, including the correctly-printed "dinaviiryaaDhyah" here -- which corroborates the disclosed readings of the same underlying phrase at verses 12 and 15. Corroborated by the page's own Hindi commentary ("vrishchik raashi ka shariir chhotaa, bahut se pair, braahmaNjaati, bil mein sansthaan, uttar dishaa mein nivaas, din mein praabalya, pishangavarN, jalatatva, bhuumi mein vicharaN, romayukt shariir, atyadhik tej Dank, tathaa svaamii bhaum hote hain || 16 ||"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पृष्ठोदयी त्वथ धनुर्गुरुस्वामी च सात्विकः ॥ १७ ॥

prishthodayii tvatha dhanurgurusvaamii cha saatvikah || 17 ||

अंग्रेज़ी अर्थ

Rising by the back (prishtha-udayii), and now (tv-atha) [comes] Dhanu (the Bow, i.e. Sagittarius), ruled by Guru (Jupiter, guru-svaamii), and of sattva-guna (saatvikah).

हिन्दी अर्थ

पीठ से उदय होने वाली, और अब धनु राशि है, जिसका स्वामी गुरु (बृहस्पति) है, तथा जो सत्त्वगुणी है।

स्रोत: BPHS Ch.5, verse 17 (first of the two-verse 17-18 unit for Dhanu, explicitly closed by the page's own combined citation "॥१७-१८॥"), Kashi Sanskrit Series No.220, PDF p.68, read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p68-v17-18.png) confirming the printed text letter-by-letter. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पिङ्गलो निशि वीर्याढ्यः पावकः क्षत्रियो द्विपात् । आदावन्ते चतुष्पादः समगात्रो धनुर्धनः ॥ १८ ॥ पूर्वस्थो वसुधाचारी वहुतेजः समन्वितः ।

pingalo nishi viiryaaDhyah paavakah kshatriyo dvipaat | aadaavante chatushpaadah samagaatro dhanurdhanah || 18 || puurvastho vasudhaachaarii vahutejah samanvitah |

अंग्रेज़ी अर्थ

Tawny-colored (pingalah), of night-strength (nishi viiryaaDhyah), fiery [in element] (paavakah), of Kshatriya [caste], two-footed at the outset (aadau dvipaat) [DISCLOSED: reflecting, per the commentary's "purvaardha mein do pair, aur uttaraardha mein chaar pair" (two feet in the first half, four in the second), the archer's composite human-and-horse form] and four-footed at the end (ante chatushpaadah); of uniform body (sama-gaatrah), bow-wielding (dhanur-dhanah); dwelling in the east (purva-sthah), earth-wandering (vasudhaa-chaarii), endowed with abundant radiance (vahu-tejah samanvitah).

हिन्दी अर्थ

पिंगल वर्ण का, रात्रि में बलवान्, अग्नितत्त्व वाला, क्षत्रिय जाति का; आरम्भ में दो पैरों वाला [स्पष्टीकरण: टीका के "पूर्वार्ध में दो पैर, और उत्तरार्ध में चार पैर" के अनुसार, धनुर्धारी के नर-अश्व मिश्रित रूप को दर्शाता हुआ] तथा अन्त में चार पैरों वाला; समान शरीर वाला, धनुर्धारी; पूर्व दिशा में निवास करने वाला, पृथ्वी पर विचरण करने वाला, अत्यधिक तेज से युक्त है।

स्रोत: BPHS Ch.5, verse 18 (three-line unit: numbered after line 2, with an unnumbered continuation line 3), Kashi Sanskrit Series No.220, PDF p.68, read from a clean 600dpi full-page render and further direct band-crop zooms (scratchpad/bphs-p68-v17-18.png, bphs-p68-v18c.png) confirming the printed text letter-by-letter. Closes the two-verse (17-18) Dhanu description, corroborated by the page's own Hindi commentary ("dhanuraashi kaa prishtha se uday, svaamii guru, sattvaguN, pingalavarN, raatri mein praabalya, agnitatva, kshatriyavarN, purvaardha mein do pair, aur uttaraardha mein chaar pair, samaan shariir, dhanurdhaaraN, purva dishaa mein nivaas, prithvi par vicharaN, tathaa amit tej hotaa hai || 17-18 ||"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मन्देशस्तामसो भूमियाम्येट् च निशि वीर्यवान् ॥ १९ ॥

mandeshastaamaso bhuumiyaamyeT cha nishi viiryavaan || 19 ||

अंग्रेज़ी अर्थ

Ruled by Manda (Saturn, manda-ishah), of tamo-guna, of the earth [element] (bhuumi); [DISCLOSED: the text here reads "yaamyeT", the identical anomalous form already disclosed at verse 8 -- its recurrence here, corroborated by this page's commentary explicitly stating "dakshiNa disha mein nivaas" (dwelling in the south direction) for this sign, strongly supports reading it as intending "yaamye", i.e. "in the south"]; potent at night (nishi viiryavaan).

हिन्दी अर्थ

मन्द (शनि) द्वारा शासित, तमोगुणी, भूमितत्त्व वाला; [स्पष्टीकरण: यहाँ पाठ में "याम्येट्" शब्द है, जो श्लोक ८ में पहले से प्रकट हुए उसी असामान्य रूप के समान है -- यहाँ की टीका के स्पष्ट "दक्षिण दिशा में निवास" कथन से इसकी पुनरावृत्ति दृढ़तापूर्वक "याम्ये" (दक्षिण दिशा में) अर्थ का समर्थन करती है]; रात्रि में बलवान् है।

स्रोत: BPHS Ch.5, verse 19 (first of the two-verse 19-20 unit for Makara, explicitly closed by the page's own combined citation "॥१९-२०॥"), Kashi Sanskrit Series No.220, PDF p.68, read from a clean 600dpi full-page render and a further direct band-crop zoom (scratchpad/bphs-p68-v19-20.png) confirming the printed text letter-by-letter, including the sandhi-joined "bhuumiyaamyeT" (bhuumi + yaamyeT). This is the second occurrence in this chapter of the anomalous "yaamyeT" form first seen at verse 8, strengthening confidence in its disclosed reading. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पृष्ठोदयी वृहद्गात्रः कर्बुरो वनभूचरः । आदौ चतुष्पादन्ते तु विपदो जलगो मतः ॥ २० ॥

prishthodayii vrihadgaatrah karburo vanabhuucharah | aadau chatushpaadante tu vipado jalago matah || 20 ||

अंग्रेज़ी अर्थ

[Continuing from verse 19:] rising by the back (prishtha-udayii), large-bodied (vrihad-gaatrah), spotted/variegated-colored (karburah), forest-and-earth-wandering (vana-bhuu-charah); at first four-footed (aadau chatushpaat), at the end, however, footless (ante tu vipadah), considered (matah) to move in water (jala-gah) -- [thus is Makara, a hybrid land-and-water creature, i.e. Capricorn].

हिन्दी अर्थ

[श्लोक १९ से आगे:] पीठ से उदय होने वाला, बड़े शरीर वाला, चितकबरे (धब्बेदार) वर्ण का, वन तथा भूमि में विचरण करने वाला; आरम्भ में चतुष्पद, किन्तु अन्त में पैर-रहित, तथा जल में संचरण करने वाला माना गया है -- यह मकर राशि है।

स्रोत: BPHS Ch.5, verse 20, Kashi Sanskrit Series No.220, PDF p.68, read from a clean 600dpi full-page render and the same direct band-crop zoom (scratchpad/bphs-p68-v19-20.png) confirming the printed text letter-by-letter. Closes the two-verse (19-20) Makara description, corroborated by the page's own Hindi commentary ("makar raashi kaa svaamii shani, taamas guN, bhuumitatva, dakshiN dishaa mein nivaas, raatri mein praabalya, prishtha se uday, badaa shariir, chitravarN, van tathaa bhuumi mein chalan, purvaardha mein chatushpad, uttaraardha mein padrahitya, aur jal mein sancharaN hotaa hai || 19-20 ||"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कुम्भः कुम्भी नरो वभ्रुवर्णो मध्यतनुर्द्विपात् । घुवीर्या जलमध्यस्थो वातशीर्षोदयी तमः ॥ २१ ॥ शूद्रः पश्चिमदेशस्य स्वामी दैवाकरिः स्मृतः ।

kumbhah kumbhii naro vabhruvarNo madhyatanurdvipaat | ghuviiryaa jalamadhyastho vaataashiirshodayii tamah || 21 || shuudrah pashchimadeshasya svaamii daivaakarih smritah |

अंग्रेज़ी अर्थ

Kumbha (the Water-pot, i.e. Aquarius) is a pot-bearing man in form (kumbhii narah), of grayish-brown color (vabhru-varNah), of middling body, two-footed; endowed with day-strength (ghu-viiryaa) [here, unlike the anomalous forms left disclosed at verses 12 and 15, the very next page's own commentary directly and unambiguously glosses this as "dina mein praabalya" -- day-predominance -- fully confirming that this same underlying sense (day-strength) was intended by all three verses, even though each is spelled differently], situated in the midst of water (jala-madhyasthah), of the air [element] and rising by the head (vaata-shiirsha-udayii), of tamo-guna (tamah); of Shudra [caste], dwelling in the western region (pashchima-deshasya), and is remembered as ruled by (svaamii...smritah) Daivakari [an epithet of Shani/Saturn: "offspring of Divakara, the Sun"].

हिन्दी अर्थ

कुम्भ (घड़ा) राशि घड़ा लिए हुए पुरुष के समान स्वरूप वाली, भूरे वर्ण की, मध्यम शरीर वाली, दो पैरों वाली है; दिन में बलवान् [स्पष्टीकरण: श्लोक १२ तथा १५ में जिन असामान्य रूपों को खुला छोड़ा गया था, उनके विपरीत यहाँ अगले पृष्ठ की टीका सीधे और स्पष्ट रूप से इसे "दिन में प्राबल्य" कहकर पुष्ट करती है -- इससे सिद्ध होता है कि तीनों श्लोकों का अभिप्राय एक ही (दिन में बल) था, चाहे वर्तनी भिन्न-भिन्न क्यों न हो], जल के मध्य में स्थित, वायुतत्त्व वाली तथा सिर से उदय होने वाली, तामसी; शूद्र जाति की, पश्चिम दिशा में निवास करने वाली, तथा दैवाकरि (शनि का एक नाम, अर्थात् दिवाकर -- सूर्य -- की सन्तान) द्वारा शासित मानी गई है।

स्रोत: BPHS Ch.5, verse 21 (four-line unit: two lines numbered ॥२१॥, followed by an unnumbered continuation line that carries over onto the next printed page, consistent with the multi-line-unit convention already seen at verses 16 and 18), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF pp.68-69, read from clean 600dpi full-page renders and further direct zoom crops (scratchpad/bphs-p68-v21.png, bphs-p68-v21-line2b.png, bphs-p69-v21cont2.png) confirming the printed text letter-by-letter across the page break. Fully corroborated by the page-69 commentary opening ("kumbha raashi kaa ghadaa liye hue purush jaisaa svaruup, bhuraa varN, madhyam shariir, do pair, din mein praabalya, paani ke madhya mein sanchaar, vaayutatva, shiirsh se uday, taamas guN, shuudrajaati, pashchim dishaa mein nivaas, tathaa svaamii shani hai || 21 ||"), which also retroactively strengthens the disclosed "day-strength" readings at verses 12 and 15. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मीनौ पुच्छास्यसंलग्नौ मीनराशिर्द्विवावली ॥ २२ ॥

miinau puchchhaasyasanlagnau miinaraashirdvivaavalii || 22 ||

अंग्रेज़ी अर्थ

The two fish (miinau), joined together at tail-and-mouth (puccha-aasya-sanlagnau) -- the Meena sign (i.e. Pisces) is thus a double row, or pair [of fish] (dvi-avalii). [DISCLOSED: the printed compound "dvivaavalii" is a compressed/anomalous form; it is read here as intending "dvi-avalii" (a double row, or pair), directly corroborated by the very next page's own commentary describing Meena as "mukha-puchchha milit do machhaliyon kaa saa svaruup" -- the form of two fish joined at mouth and tail.]

हिन्दी अर्थ

पुच्छ और मुख से परस्पर जुड़े हुए दो मीन (मछलियाँ) -- इस प्रकार मीन राशि दो मछलियों की जोड़ी (द्वि-अवली) है। [स्पष्टीकरण: मुद्रित संयुक्त शब्द "द्विवावली" एक संक्षिप्त/असामान्य रूप है; इसे यहाँ "द्वि-अवली" (जोड़ी) के अर्थ में समझा गया है, जिसकी पुष्टि अगले पृष्ठ की टीका के "मुख-पुच्छ मिलित दो मछलियों का सा स्वरूप" कथन से सीधे होती है।]

स्रोत: BPHS Ch.5, verse 22, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.69 (printed page 40, chapter header "राशिशीलाध्यायः"), read from a clean 600dpi full-page render and further direct zoom crops (scratchpad/bphs-p69-v22-full.png, bphs-p69-v22-word.png) confirming the printed text letter-by-letter. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जली सत्त्वगुणाढ्यश्च स्वस्थो जलचरो द्विजः । अपदो मध्यदेही च सौम्यस्थो ह्युभयोदया ॥ २३ ॥

jalii sattvaguNaaDhyashcha svastho jalacharo dvijah | apado madhyadehii cha saumyastho hyubhayodayaa || 23 ||

अंग्रेज़ी अर्थ

Of the water [element] (jalii), and endowed with sattva-guna (sattva-guNaaDhyah), composed/healthy [in appearance] (svasthah), water-moving (jalacharah), of the twice-born [Brahmin caste] (dvijah); footless (apadah), of middling body (madhya-dehii), situated in the north (saumya-sthah), and [DISCLOSED: the text prints "hyubhayodayaa", with an anomalous "hy" before the expected "ubhaya-udayaa" -- rising by both [ends] -- directly corroborated by the following commentary's own "mukha-puchchha donon se uday", rising by both mouth and tail] rising by both [mouth and tail].

हिन्दी अर्थ

जलतत्त्व वाली, सत्त्वगुणी, स्वस्थ (सुडौल) मुख वाली, जल में विचरण करने वाली, द्विज (ब्राह्मण) जाति की; पैर-रहित, मध्यम शरीर वाली, उत्तर दिशा में स्थित, तथा [स्पष्टीकरण: पाठ में "ह्युभयोदया" मुद्रित है, जिसमें अपेक्षित "उभयोदया" (दोनों ओर से उदय) से पहले असामान्य "ह्य" जुड़ा है -- इसकी पुष्टि आगे की टीका के "मुख-पुच्छ दोनों से उदय" कथन से सीधे होती है] मुख तथा पुच्छ दोनों से उदय होने वाली है।

स्रोत: BPHS Ch.5, verse 23, Kashi Sanskrit Series No.220, PDF p.69, read from a clean 600dpi full-page render and further direct zoom crops (scratchpad/bphs-p69-v23-word2.png, bphs-p69-v23-word3.png) taken specifically to resolve the anomalous "hyubhayodayaa", confirmed as printed exactly this way. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुराचार्याधिपश्चेत्थं राशीनामुदिता गुणाः । त्रिंशद्भागात्मकानां च स्थूलसूक्ष्मफलाय च ॥ २४ ॥

suraachaaryaadhipashchettham raashiinaamuditaa guNaah | trimshadbhaagaatmakaanaam cha sthuulasuukshmaphalaaya cha || 24 ||

अंग्रेज़ी अर्थ

[Meena is] thus ruled by Suracharya (the preceptor of the gods, i.e. Brihaspati/Jupiter). In this way (ittham) have the qualities (guNaah) of the signs (raashiinaam), each constituted of thirty parts/degrees (trimshad-bhaaga-aatmakaanaam), been declared (uditaah), for the sake of both gross and subtle results (sthuula-suukshma-phalaaya).

हिन्दी अर्थ

इस प्रकार सुराचार्य (देवगुरु बृहस्पति) द्वारा शासित है [मीन राशि]। इस प्रकार तीस अंशों से युक्त राशियों के गुण, स्थूल तथा सूक्ष्म फलादेश दोनों के लिए, कहे गए हैं।

स्रोत: BPHS Ch.5, verse 24, Kashi Sanskrit Series No.220, PDF p.69, read from a clean 600dpi full-page render and further direct zoom crops (scratchpad/bphs-p69-v24-line1.png, bphs-p69-v24.png) confirming the printed text letter-by-letter. Closes the three-verse (22-24) Meena description and the twelve-sign raashi-guna exposition, explicitly cited by the page's own commentary as "॥२२-२४॥" ("is prakaar sthuul evam suukshm phalaadeshon ke liye trimshadbhaagaatmak raashiyon kaa guN mainne batalaayaa hai"). CORRECTION (superseding an earlier disclosed guess): the page then continues with a further subheaded subsection on garbhaadhaana/nisheka-lagna (conception-time computation, verses 25-30) that is STILL part of Chapter 5 -- the chapter's actual colophon, confirmed on the following page (PDF p.70), reads "iti savimarsha-sudhaakhyaakhyopetaayaam brihatpaaraashara-horaayaam raashishiilaadhyaayah samaaptah || 5 ||", closing the chapter only after verse 30, not here at verse 24. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथातः सम्प्रवक्ष्यामि शृणुष्व मुनिपुङ्गव । जन्मकालं च संशोध्य निषेकं परिशोधयेत् ॥ २५ ॥

athaatah samprvakshyaami shriNushva munipungava | janmakaalam cha sanshodhya nishekam parishodhayet || 25 ||

अंग्रेज़ी अर्थ

Now, therefore (atha atah), I shall declare (samprvakshyaami) -- listen, O foremost of sages (muni-pungava)! Having ascertained/corrected (sanshodhya) the birth-time (janma-kaalam), one should [thereby] determine (parishodhayet) the [time of] conception (nishekam).

हिन्दी अर्थ

अब इसके पश्चात् मैं कहूँगा -- हे मुनिश्रेष्ठ ! सुनिए। जन्मकाल का भलीभाँति शोधन करके निषेक (गर्भाधान) काल का परिशोधन (निर्धारण) करना चाहिए।

स्रोत: BPHS Ch.5, verse 25, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.69 (printed page 40, chapter header "राशिशीलाध्यायः"), read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p69-v25-30.png) confirming the printed text letter-by-letter. Opens a new subsection (introduced on the page by the Hindi editorial subheading "जन्मकाल से गर्भाधान समय का ज्ञान--") on computing the nisheka-lagna (conception-time ascendant) from the birth-time; this subsection runs through verse 30 and is still part of Chapter 5 -- see the correction recorded at verse 5.24's source field, and the chapter's actual colophon confirmed at verse 5.30 below. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तदहं सम्प्रवक्ष्यामि मैत्रेय ! त्वं विधारय । जन्मलग्नात् परिज्ञानं निषेकं सर्वजं तु यत् ॥ २६ ॥

tadaham samprvakshyaami maitreya! tvam vidhaaraya | janmalagnaat parijnaanam nishekam sarvajam tu yat || 26 ||

अंग्रेज़ी अर्थ

That I shall now declare, O Maitreya! Hold it well in mind (vidhaaraya). From the birth-ascendant (janma-lagnaat), the complete/full understanding (parijnaanam ... sarvajam) of the conception[-time ascendant] (nishekam), which [is to be known thus] --

हिन्दी अर्थ

वह मैं अब कहूँगा, हे मैत्रेय ! तुम इसे भलीभाँति धारण करो। जन्मलग्न से निषेक (गर्भाधान-काल) का सम्पूर्ण ज्ञान इस प्रकार प्राप्त होता है --

स्रोत: BPHS Ch.5, verse 26, Kashi Sanskrit Series No.220, PDF p.69, read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p69-v26-28.png) confirming the printed text letter-by-letter. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यस्मिन् भावे भानविः स्यात्तस्य मान्देर्यदन्तरम् । लग्नभाग्यान्तरं योज्यं यच्च राश्यादि जायते ॥ २७ ॥

yasmin bhaave bhaanavih syaattasya maanderyadantaram | lagnabhaagyaantaram yojyam yachcha raashyaadi jaayate || 27 ||

अंग्रेज़ी अर्थ

In whichever bhaava (house) Bhaanavi [DISCLOSED: read here, as at verse 21's "daivaakarih", as an epithet of Shani/Saturn -- "son of Bhaanu, the Sun" -- though this second Saturn-epithet has not yet been independently corroborated by the page's own commentary the way "daivaakarih" was] would be, whatever (yat) is its (tasya) difference (antaram) from Mandi [Gulika] [DISCLOSED: the printed compound "maanderyadantaram" is read as sandhi of "maandeh + yat + antaram", i.e. "the difference which is [reckoned] from Mandi"] -- the difference (antaram) between the lagna (ascendant) and the bhaagya [the 9th house, "fortune"] should be added (yojyam) to that, and whatever sign etc. (raashyaadi) results (jaayate) [from this sum, that is the figure to be used].

हिन्दी अर्थ

जिस भाव में भानवि (शनि, "भानु अर्थात् सूर्य का पुत्र" -- [स्पष्टीकरण: श्लोक २१ के "दैवाकरिः" के समान यहाँ भी शनि का एक नामान्तर मानकर पढ़ा गया है, यद्यपि इसकी पुष्टि पृष्ठ की टीका से अभी स्वतन्त्र रूप से नहीं हुई है]) स्थित हो, उससे मान्दि (गुलिक) का जो अन्तर हो [स्पष्टीकरण: मुद्रित संयुक्त शब्द "मान्देर्यदन्तरम्" को "मान्देः + यत् + अन्तरम्" के सन्धि-रूप में पढ़ा गया है] -- उसमें लग्न और भाग्य (नवम भाव) के अन्तर को जोड़ना चाहिए, और जो राशि आदि उससे प्राप्त हो [वही प्रयोज्य अंक है]।

स्रोत: BPHS Ch.5, verse 27, Kashi Sanskrit Series No.220, PDF p.69, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p69-v26-28.png, bphs-p69-v27-line2.png) confirming the printed text letter-by-letter. This verse states a technical calculation rule (a difference involving Saturn/Bhanavi, Mandi/Gulika, the lagna and the 9th house) whose precise computational procedure is not fully spelled out by the page's own prose commentary (which paraphrases verses 25-30 only in general terms); the translation above is offered at the level of the literal Sanskrit grammar, with the exact astronomical procedure left for the reader/practitioner's own technical judgment rather than fabricated here. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मासादि तन्मितं ज्ञेयं जन्मतः प्राग् निषेकजम् । यद्दृश्यदलग्नेशः तदेन्दोर्भुक्तभागयुक् ॥ २८ ॥

maasaadi tanmitam jneyam janmatah praag nishekajam | yaddRishyadalagneshah tadendorbhuktabhaagayuk || 28 ||

अंग्रेज़ी अर्थ

That measure (tat-mitam), [reckoned] in months etc. (maasa-aadi), is to be known (jneyam) as the [time interval] arising from conception (nisheka-jam), prior to (praag) the birth (janmatah). If the lagna-lord [DISCLOSED: "yad-dRishya-dala-lagneshah" is read as "if [it/the relevant reckoning-point] is the lord of the visible half [of the zodiac counted] from the lagna" -- the page's own prose commentary paraphrases this passage instead in terms of the lagna-lord being in the invisible ("adRishya") half, a nuance not fully reconciled here with the verse's own "dRishya" ("visible"); both readings are disclosed rather than silently harmonized] [is so placed], then [add to it] the Moon's traversed portion/degrees (indoh bhukta-bhaaga-yuk).

हिन्दी अर्थ

वह मान (मासादि में) जन्म से पूर्व निषेकजनित काल के रूप में जानना चाहिए। यदि [गणना-बिन्दु] लग्न से दृश्य अर्ध का स्वामी हो [स्पष्टीकरण: पृष्ठ की टीका इसी अंश को इसके विपरीत "अदृश्य" (अदृश्य चक्रार्ध) के रूप में स्पष्ट करती है -- यह भेद यहाँ खुला छोड़ा गया है, दोनों पाठ प्रस्तुत किए बिना किसी एक को चुपचाप सही मान लिए] तो उसमें चन्द्रमा के भुक्त भाग (गति किए हुए अंश) जोड़ने चाहिए।

स्रोत: BPHS Ch.5, verse 28, Kashi Sanskrit Series No.220, PDF p.69, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p69-v26-28.png, bphs-p69-v28-line2.png) confirming the printed text letter-by-letter. The page's own prose commentary/worked example (PDF p.69-70) paraphrases verses 25-30 together as: "janma se pahle garbhaadhaan kaa samay samajhnaa chaahiye. yadi lagnesh adRishya chakraardh mein (lagna se agrim 6 raashi mein) sthit hon to purv siddh raashyaadi mein chandramaa kaa bhuktaansh joden." -- this general paraphrase is used only as corroborating context, not as verse content, and the disclosed dRishya/adRishya tension above is left for the reader's own resolution. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तत्काले साधयेल्लग्नं शोधयेत् पूर्ववत्तनुम् । तस्माच्छुभाशुभं वाच्यं गर्भस्थस्यविशेषतः ॥ २९ ॥

tatkaale saadhayellagnam shodhayet puurvavattanum | tasmaachchhubhaashubham vaachyam garbhasthasyavisheshatah || 29 ||

अंग्रेज़ी अर्थ

At that time [so determined], one should establish/compute (saadhayet) the [conception-time] ascendant (lagnam), correcting/refining the [ascendant-]body (tanum) as before (puurvavat). From that, auspicious and inauspicious [results] (shubha-ashubham) are to be declared (vaachyam), especially (visheshatah) for the being situated in the womb (garbha-sthasya).

हिन्दी अर्थ

उस [निर्धारित] काल में [निषेक-] लग्न को साधना (निकालना) चाहिए, तथा लग्न-शरीर का शोधन पूर्ववत् करना चाहिए। उससे शुभ-अशुभ फल कहने चाहिए, विशेषतः गर्भस्थ जीव के सम्बन्ध में।

स्रोत: BPHS Ch.5, verse 29, Kashi Sanskrit Series No.220, PDF p.69, read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p69-v29-30.png) confirming the printed text letter-by-letter. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुभाशुभं वदेत्पित्रोर्जीवनं मरणं तथा । एवं निषेकलग्नेन सम्यग् ज्ञेयं स्वकल्पनात् ॥ ३० ॥

shubhaashubham vadetpitrorjiivanam maraNam tathaa | evam nishekalagnena samyag jneyam svakalpanaat || 30 ||

अंग्रेज़ी अर्थ

One should declare (vadet) the auspicious and inauspicious [results] (shubha-ashubham) regarding the life (jiivanam) and death (maraNam) of the parents (pitroh) as well (tathaa). Thus (evam), by means of the conception-time ascendant (nisheka-lagnena), [the results] should be properly known (samyag jneyam) through one's own [technical] judgment/reckoning (sva-kalpanaat).

हिन्दी अर्थ

माता-पिता के जीवन तथा मरण से सम्बन्धित शुभ-अशुभ फल भी कहने चाहिए। इस प्रकार निषेक-लग्न के द्वारा, अपनी [ज्योतिषीय] कल्पना (गणना-कौशल) से, फलों को भलीभाँति जानना चाहिए।

स्रोत: BPHS Ch.5, verse 30 (the chapter's final verse), Kashi Sanskrit Series No.220, PDF p.69, read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p69-v29-30.png) confirming the printed text letter-by-letter. This verse is immediately followed on the page by the worked numerical example illustrating verses 25-30, and then by the chapter's formal Sanskrit colophon (PDF p.70, scratchpad/bphs-p70-small.png): "इति सविमर्शसुधाख्याख्योपेतायां बृहत्पाराशरहोरायां राशिशीलाध्यायः समाप्तः ॥ ५ ॥" ("Thus ends, in the Brihat-Parashara-Hora accompanied by the commentary named Savimarsha-Sudha, the chapter on the nature of the signs, the fifth.") -- this directly confirms Chapter 5 closes here, after verse 30, superseding the earlier disclosed (and incorrect) guess at verse 5.24 that the chapter closed at verse 24. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ग्रहाणामथ राशीनां ये गुणा भवतोदिताः । श्रुता इदानीं शुश्रूषु भावभेदांश्च तान् वद ॥ १ ॥

grahaaNaamatha raashiinaam ye guNaa bhavatoditaah | shrutaa idaaniim shushruushu bhaavabhedaanshcha taan vad || 1 ||

अंग्रेज़ी अर्थ

Maitreya said: Now, the qualities (guNaah) of the planets (grahaaNaam) and of the signs (raashiinaam) that were declared (uditaah) by you (bhavataa) have been heard (shrutaa) by me. Now (idaaniim) I am desirous of hearing (shushruushuh) -- please tell (vad) me those (taan) distinctions of the bhaavas (houses) as well (bhaava-bhedaan cha).

हिन्दी अर्थ

मैत्रेय ने कहा -- आपके द्वारा कहे गए ग्रहों तथा राशियों के गुण मैंने सुने। अब मैं भावों (घरों) के भेद सुनना चाहता हूँ, कृपया उन्हें भी बतलाइए।

स्रोत: BPHS Ch.6, verse 1 (Maitreya's opening question), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.70 (printed page 48, chapter header "बृहत्पाराशरहोराशास्त्रम्"), read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p70-v1.png) confirming the printed text letter-by-letter. Opens Chapter 6, titled "अथ षोडशवर्गवर्णनाध्यायः" ("the chapter describing the sixteen vargas/divisional charts"), which follows immediately after Chapter 5's confirmed colophon on this same page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वर्गान् षोडश यत्प्राह ब्रह्मा लोकपितामहः । तदहं सम्प्रवक्ष्यामि मैत्रेय ! श्रूयतामिति ॥ २ ॥

vargaan shoDasha yatpraaha brahmaa lokapitaamahah | tadaham samprvakshyaami maitreya! shruuyataamiti || 2 ||

अंग्रेज़ी अर्थ

Parashara said: The sixteen (shoDasha) vargas (divisional charts) that (yat) Brahma, the grandfather of the worlds (loka-pitaamahah), declared (praaha) -- that (tat) I shall now relate (samprvakshyaami), O Maitreya! Let it be heard (shruuyataam iti).

हिन्दी अर्थ

पराशर ने कहा -- लोकपितामह ब्रह्माजी ने जिन सोलह वर्गों का वर्णन किया है, उसे मैं अब बतलाता हूँ। हे मैत्रेय ! सुनिए।

स्रोत: BPHS Ch.6, verse 2 (Parashara's reply), Kashi Sanskrit Series No.220, PDF p.70, read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p70-v2.png) confirming the printed text letter-by-letter. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

क्षेत्रं होरा च द्रेष्काणास्तुर्यांशः सप्तमांशकः । नवांशो दशमांशश्च सूर्यांशः षोडशांशकः ॥ ३ ॥

kshetram horaa cha dreshkaaNaastuuryaanshah saptamaanshakah | navaanshah dashamaanshashcha suuryaanshah shoDashaanshakah || 3 ||

अंग्रेज़ी अर्थ

Kshetra (the sign/D-1 itself), Hora (the D-2), Dreshkana (the D-3), Turyamsha (the D-4), Saptamamsha (the D-7); Navamsha (the D-9), Dashamsha (the D-10), and Surya-amsha [DISCLOSED: the printed text reads "suuryaanshah" ("sun-portion") at exactly the position where the classical Parashari shodashavarga list has "Dwadashamsha" (the D-12); this crop was independently re-zoomed and the printed reading "सूर्यांशः" confirmed letter-by-letter, so it is transcribed exactly as printed rather than silently corrected to the expected classical term], [and] Shodashamsha (the D-16).

हिन्दी अर्थ

क्षेत्र (राशि/D-1), होरा (D-2), द्रेष्काण (D-3), तुर्यांश (D-4), सप्तमांश (D-7); नवांश (D-9), दशमांश (D-10), तथा सूर्यांश [स्पष्टीकरण: मुद्रित पाठ में ठीक उसी स्थान पर "सूर्यांशः" छपा है जहाँ पारम्परिक षोडशवर्ग-सूची में "द्वादशांश" (D-12) होना अपेक्षित है; इस अंश को पुनः ज़ूम करके अक्षर-दर-अक्षर "सूर्यांशः" ही पढ़ा गया, अतः इसे अपेक्षित पारम्परिक नाम में सुधारे बिना, जैसा मुद्रित है वैसा ही यहाँ रखा गया है] [तथा] षोडशांश (D-16) -- [ये वर्ग कहे गए हैं]।

स्रोत: BPHS Ch.6, verse 3 (first half of the sixteen-varga name list), Kashi Sanskrit Series No.220, PDF p.70, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p70-v3-line1.png, bphs-p70-v3.png, bphs-p70-v3l1-word.png, bphs-p70-v3-word2.png) taken specifically to resolve two technical terms letter-by-letter: "सप्तमांशकः" (confirmed via a tight crop showing the प्त conjunct clearly, correcting an initial misreading of "ससमांशकः" from the lower-resolution overview) and "सूर्यांशः" (confirmed as printed, though it does not match the expected classical term "द्वादशांशः"/Dwadashamsha at this position in the standard 16-varga sequence -- disclosed in the translation above rather than silently emended). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विंशांशो वेदवाह्वंशो भांशत्रिंशांशकस्ततः । खवेदांशोऽक्षवेदांशः षष्ट्यंशश्च ततः परम् ॥ ४ ॥

vinshaanshah vedavaahvanshah bhaanshatrinshaanshakastatah | khavedaanshoakshavedaanshah shashTyanshashcha tatah param || 4 ||

अंग्रेज़ी अर्थ

Vimshamsha (the D-20); "Veda-vaahu-amsha" [DISCLOSED: read as a bhuta-sankhya numeral-encoded name -- "veda" (the four Vedas) = 4, "vaahu" (the two arms) = 2, giving "24" -- i.e. intending Chaturvimshamsha, the D-24; this decoding is offered as the most plausible sense but is not itself printed as a plain number, so it is flagged rather than silently substituted], thereafter (tatah) Bhamsha [an alternate name for Saptavimshamsha/Nakshatramsha, the D-27] [and] Trimshamsha (the D-30); Khavedamsha (the D-40) [kha (0) + veda (4) = "40"], Akshavedamsha (the D-45), and thereafter (tatah param), the Shashtyamsha (the D-60).

हिन्दी अर्थ

विंशांश (D-20); "वेदवाह्वंश" [स्पष्टीकरण: इसे भूतसंख्या पद्धति में पढ़ा गया है -- "वेद" (चार वेद) = ४, "वाहु" (दो भुजाएँ) = २, अर्थात् "२४" -- यानी चतुर्विंशांश (D-24) का सूचक; यह व्याख्या सर्वाधिक सम्भावित अर्थ के रूप में प्रस्तुत है, परन्तु मुद्रित पाठ में सीधे अंकों में नहीं है, अतः इसे चुपचाप अंक से प्रतिस्थापित करने के बजाय स्पष्ट रूप से बताया गया है], तत्पश्चात् भांश [सप्तविंशांश/नक्षत्रांश (D-27) का एक अन्य नाम] [तथा] त्रिंशांश (D-30); खवेदांश (D-40) [ख (०) + वेद (४) = "४०"], अक्षवेदांश (D-45), तथा उसके पश्चात् षष्ट्यंश (D-60) -- [ये सोलह वर्ग हैं]।

स्रोत: BPHS Ch.6, verse 4 (second half of the sixteen-varga name list, completing the shodashavarga enumeration begun at verse 3), Kashi Sanskrit Series No.220, PDF p.70, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p70-v4l1a.png, bphs-p70-v4l1b.png) confirming the printed text letter-by-letter. The final two names, Khavedamsha and Akshavedamsha, are themselves standard bhuta-sankhya numeral-encoded terms (kha=0, veda=4 -> 40; a comparable pattern is disclosed as the likely sense of "vedavaahvamsha" -> Chaturvimshamsha/D-24 earlier in the verse), and "Bhamsha" is a recognized alternate name for Saptavimshamsha (Nakshatramsha, D-27), corroborating the classical sixteen-varga sequence: D1, D2, D3, D4, D7, D9, D10, [D12], D16, D20, D24, D27, D30, D40, D45, D60 (the D12 slot being the disclosed "suuryaanshah" anomaly noted at verse 6.3). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तत्क्षेत्रं तस्य खेटस्य राशेर्यो यस्य नायकः । सूर्येन्द्रोर्विषमे राशौ समे तद् विपरीतकम् ॥ ५ ॥

tatkshetram tasya khetasya raasheryo yasya naayakah | suuryendrorvishame raashau same tad vipariitakam || 5 ||

अंग्रेज़ी अर्थ

That (tat) is the Kshetra (own-sign, D-1) of that planet (khetasya) which (yah) is the lord (naayakah) of the sign (raasheh). [As for the Hora, D-2:] of Surya (the Sun) and Indu (the Moon), in an odd (vishame) sign [the first half belongs to the Sun's hora and the second to the Moon's]; in an even (same) sign, that (tat) is reversed (vipariitakam).

हिन्दी अर्थ

वह (राशि) उस ग्रह का क्षेत्र (स्वराशि, D-1) है जो उस राशि का स्वामी है। [होरा (D-2) के विषय में:] सूर्य और चन्द्रमा में से, विषम राशि में [पूर्वार्ध सूर्य की होरा तथा उत्तरार्ध चन्द्रमा की होरा होती है]; सम राशि में यह विपरीत हो जाता है।

स्रोत: BPHS Ch.6, verse 5, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.71 (printed page 39, chapter header "षोडशवर्गवर्णनाध्यायः"), read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p71-v5.png) confirming the printed text letter-by-letter. Directly corroborated by the page's own Hindi prose commentary on verses 5-6 ("mesh, mithun aadi visham raashiyon mein purvaardh 15 ansh suury kii horaa, tathaa uttaraardh 15 ansh chandramaa kii horaa"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पितरश्चन्द्रहोरेशा देवाः सूर्यस्य कीर्तिताः । राशेरर्धं भवेद्धोरास्ताश्चतुर्विंशतिः स्मृता ॥ ६ ॥ मेषादि तासां होराणां परिवृत्तिद्वयं भवेत् ।

pitarashchandrahoreshaa devaah suuryasya kiirtitaah | raasheh ardham bhaveddhoraastaashchaturvinshatih smritaa || 6 || meshaadi taasaam horaaNaam parivrittidvayam bhavet |

अंग्रेज़ी अर्थ

The lords of the Moon's hora are declared to be the Pitris (ancestral manes); those of the Sun's [hora] are celebrated (kiirtitaah) as the Devas (gods). Half of a sign (raasheh ardham) constitutes a hora (bhavet horaah); these (taah) are remembered (smritaah) as twenty-four (chaturvinshatih) [in total, across the zodiac]. Beginning from Mesha (Aries), of these horas a double cycle/repetition (parivritti-dvayam) occurs (bhavet) [across the twelve signs].

हिन्दी अर्थ

चन्द्रमा की होरा के स्वामी पितृगण कहे गए हैं, तथा सूर्य की होरा के स्वामी देवगण कहलाते हैं। राशि का आधा भाग एक होरा होती है; ये कुल चौबीस होराएँ मानी गई हैं। मेषादि से आरम्भ करके, इन होराओं का (सम्पूर्ण राशिचक्र में) दुहरा आवर्तन होता है।

स्रोत: BPHS Ch.6, verse 6 plus an unnumbered third line completing the couplet (per the multi-line-unit convention already seen repeatedly in Chapter 5), Kashi Sanskrit Series No.220, PDF p.71, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p71-v6.png, bphs-p71-v6cont.png) confirming the printed text letter-by-letter. The combined citation "॥५-६॥" appears twice on this page, closing both the Hindi prose commentary and the worked example for verses 5-6 together, confirming these lines form one continuous unit with verse 5. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राशित्रिभागा द्रेष्काणास्ते च षट्त्रिंशदीरिताः । परिवृत्तित्रयं तेषां मेषादेः क्रमशो भवेत् ॥ ७ ॥

raashitribhaagaa dreshkaaNaaste cha shaTtrinshadiiritaah | parivrittitrayam teshaam meshaadeh kramasho bhavet || 7 ||

अंग्रेज़ी अर्थ

The third-parts of a sign (raashi-tri-bhaagaah) are the Dreshkanas (D-3); they (te) are declared (iiritaah) to be thirty-six (shaT-trinshat) [in total, across the zodiac]. Of these, a threefold cycle/repetition (parivritti-trayam) occurs (bhavet), in sequence (kramashah), beginning from Mesha (Aries).

हिन्दी अर्थ

राशि के तीसरे भाग द्रेष्काण (D-3) कहलाते हैं; वे कुल छत्तीस बतलाए गए हैं। इनका मेषादि से क्रमशः तीन आवर्तन होता है।

स्रोत: BPHS Ch.6, verse 7, Kashi Sanskrit Series No.220, PDF p.71, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p71-v7c.png, bphs-p71-v8c.png) confirming the printed text letter-by-letter. Opens the "द्रेष्काण--" (Dreshkana) subsection heading immediately preceding it on the page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वपश्चनवमानां च राशीनां क्रमशश्च ते । नारदाऽगस्तिदुर्वासा द्रेष्काणेशाश्चरादिषु ॥ ८ ॥

svapaschanavamaanaam cha raashiinaam kramashashcha te | naaradaagastidurvaasaa dreshkaaNeshaashcharaadishu || 8 ||

अंग्रेज़ी अर्थ

And they (te), in due sequence (kramashah), [belong] to one's own, the fifth, and the ninth (sva-pancha-navama) signs (raashiinaam) [DISCLOSED: the printed compound reads "sva-pa-scha-navamaanaam", with "pascha" where the well-known classical Drekkana-lord scheme (own sign, then the 5th, then the 9th from it, i.e. the trikona/trine signs) requires "pancha" (fifth); read here as "pancha" on the strength of that well-established classical rule, though the print itself is not fully unambiguous -- CONFIRMED correct by the very next page's own Hindi commentary, which states "dvitiiya dreshkaaN usase pancham raashi kaa" (the second dreshkana belongs to the fifth sign from it)]. Narada, Agastya, [and] Durvasa are the lords of the Dreshkanas in the Chara (movable), [Sthira (fixed), and Dvisvabhava (dual)] signs respectively (charaadishu) [CORRECTION (superseding an earlier disclosed guess): this verse's "charaadishu" was initially guessed to cover only the movable-sign triad, with matching triads for the fixed and dual signs speculated to follow on a later, not-yet-transcribed page. The very next page's own Hindi commentary directly refutes this: "chara, sthira, dvisvabhaava raashiyon ke dreshkaaNaadhip kramashah Naarad, Agasti tathaa Durvaasa hote hain" (the dreshkana-lords of the movable, fixed, and dual signs are, respectively, Narada, Agastya, and Durvasa) -- i.e. this single verse already fully specifies the scheme as ONE sage per sign-quality category, matched in order to the three sages already named in the same line, not a set of three further triads awaiting later verses].

हिन्दी अर्थ

और वे, क्रमशः, अपनी राशि, पंचम, तथा नवम राशियों के [अनुसार होते हैं] [स्पष्टीकरण: मुद्रित संयुक्त शब्द में "पश्च" छपा है, जबकि सुप्रसिद्ध पारम्परिक द्रेष्काणेश-नियम (स्वराशि, फिर पंचम, फिर नवम -- अर्थात् त्रिकोण राशियाँ) के अनुसार यहाँ "पञ्च" अपेक्षित है; इस सुस्थापित पारम्परिक नियम के आधार पर इसे "पञ्च" मानकर पढ़ा गया है -- अगले ही पृष्ठ की टीका "द्वितीय द्रेष्काण उससे पञ्चम राशि का" कहकर इसकी पुष्टि करती है]। नारद, अगस्ति, तथा दुर्वासा क्रमशः चर (चल), [स्थिर, तथा द्विस्वभाव] राशियों में द्रेष्काणों के स्वामी हैं [सुधार (पूर्व में प्रकट किए गए एक अनुमान का संशोधन): पहले यह अनुमान लगाया गया था कि "चरादिषु" केवल चर राशियों की त्रयी बतलाता है, तथा स्थिर व द्विस्वभाव राशियों की सम्बन्धित त्रयियाँ किसी आगामी पृष्ठ पर अपेक्षित हैं। अगले ही पृष्ठ की टीका इसका सीधे खण्डन करती है: "चर, स्थिर, द्विस्वभाव राशियों के द्रेष्काणाधिप क्रमशः नारद, अगस्ति तथा दुर्वासा होते हैं" -- अर्थात् यह श्लोक स्वयं ही एक-एक ऋषि प्रति राशि-वर्ग के क्रम को पूर्णतः स्पष्ट करता है, न कि आगे की त्रयियों की प्रतीक्षा में]।

स्रोत: BPHS Ch.6, verse 8, Kashi Sanskrit Series No.220, PDF p.71, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p71-v7c.png, bphs-p71-v8c.png, bphs-p71-v8line2.png) confirming the printed text letter-by-letter. Two genuine ambiguities were disclosed rather than silently resolved: the "sva-pascha-navamaanaam" vs. expected "sva-pancha-navamaanaam" reading, and the scope of "charaadishu". Both were resolved by reading the very next page (PDF p.72, printed page 40): the "pancha" reading was CONFIRMED correct, and the "charaadishu"-scope speculation (that fixed/dual-sign sage triads would appear on a later page) was found to be WRONG and is corrected above -- the page's own commentary shows this single verse already names one sage per sign-quality category (movable/Narada, fixed/Agastya, dual/Durvasa). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वक्षादि-केन्द्रपतयस्तुर्याशेशाः क्रियादिषु । सनकश्च सनन्दश्च कुमारश्च सनातनः ॥ ९ ॥

svakshaadi-kendrapatayasturyaasheshaah kriyaadishu | sanakashcha sanandashcha kumaarashcha sanaatanah || 9 ||

अंग्रेज़ी अर्थ

The lords of the kendras (quadrants: the 1st, 4th, 7th, and 10th) counted from one's own [sign] (svakshaadi) [DISCLOSED: the printed compound reads "svakshaadi", where the well-established classical phrase for this same rule is "svarkshaadi" (sva + rikshaadi, "beginning from one's own constellation/sign", via the regular sandhi of sva + rikkṣa); the crop was independently re-zoomed and no repha stroke was found before "ksha", so the print is transcribed exactly as "svakshaadi" rather than silently corrected -- the intended sense, kendra-lords reckoned from the natal/own sign, is unambiguous regardless] are the lords of the Turyamsha (Chaturthamsha, the D-4) [DISCLOSED: the printed compound reads "turyaasheshaah", lacking the anusvara expected in the standard classical form "turyaamsheshaah" (turya-amsha-ishaah, "lords of the fourth division"); a dedicated zoom crop confirmed no anusvara dot is printed between "yaa" and "she", so it is transcribed exactly as printed], in the movable [signs] and so forth (kriyaadishu, i.e. Aries etc. -- the sign-quality categories). [The four D-4 lords are] Sanaka, Sananda, Kumara, and Sanatana.

हिन्दी अर्थ

अपनी राशि से आरम्भ करके केन्द्रों (१, ४, ७, १० भावों) के स्वामी [स्पष्टीकरण: मुद्रित पाठ में "स्वक्षादि" छपा है, जबकि इस नियम के लिए सुप्रसिद्ध पारम्परिक शब्द "स्वर्क्षादि" (स्व+ऋक्षादि, स्व+ऋ के सन्धि-नियम से) है; अंश को पुनः ज़ूम करके देखने पर "क्ष" से पहले कोई "र्" रेफ नहीं मिला, अतः जैसा मुद्रित है वैसा ही रखा गया है -- फिर भी अभिप्रेत अर्थ, अर्थात् जन्मराशि से गिने गए केन्द्रों के स्वामी, स्पष्ट है] तुर्यांश (चतुर्थांश, D-4) के स्वामी होते हैं [स्पष्टीकरण: मुद्रित पाठ में "तुर्याशेशाः" छपा है, जिसमें मानक पारम्परिक रूप "तुर्यांशेशाः" में अपेक्षित अनुस्वार नहीं है; एक विशेष ज़ूम से पुष्टि हुई कि "या" और "शे" के बीच कोई अनुस्वार बिन्दु मुद्रित नहीं है, अतः जैसा छपा है वैसा ही रखा गया है], चर आदि राशियों में। [चतुर्थांश के चार स्वामी] सनक, सनन्द, कुमार, तथा सनातन हैं।

स्रोत: BPHS Ch.6, verse 9, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.72 (printed page 40, chapter header "बृहत्पाराशरहोराशास्त्रम्"), read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p72-v9b.png, bphs-p72-v9-word1.png through bphs-p72-v9-word7.png) confirming the printed text letter-by-letter, including two dedicated zooms resolving the absence of an expected repha in "svakshaadi" and the absence of an expected anusvara in "turyaasheshaah". Opens immediately below the page's own "चतुर्थांश--" (Chaturthamsha) subsection heading. Directly corroborated by the page's own Hindi prose commentary on this verse, which restates the rule as the 1st/4th/7th/10th sign-lordship scheme for the D-4 and gives a worked example plus a "स्पष्टार्थ चतुर्थांश चक्र" table listing Sanaka/Sananda/Kumara/Sanatana as the four D-4 lords in that order. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सप्तांशपास्त्वोजगृहे गणनीया निजेशतः । युग्मराशौ तु विज्ञेयाः सप्तमक्षादिनायकात् ॥ १० ॥

saptaanshapaastvojagrihe gananiiyaa nijeshatah | yugmaraashau tu vijneyaah saptamakshaadinaayakaat || 10 ||

अंग्रेज़ी अर्थ

In an odd (oja) sign, the lords of the Saptamamsha (D-7, saptaamshapaah) are to be counted (gananiiyaah) starting from the sign's own lord (nijeshatah). In an even (yugma) sign, however (tu), they are to be known (vijneyaah) starting from the lord of the seventh [sign] onward (saptama-kshaadi-naayakaat) [DISCLOSED: the printed compound reads "saptamakshaadi", lacking the repha expected in the regular sandhi form "saptamarkshaadi" (saptama + rikshaadi, "beginning from the seventh constellation/sign") -- the identical pattern already seen at verse 9's "svakshaadi" (for the expected "svarkshaadi"), suggesting this dropped-repha spelling is a recurring feature of this print edition rather than an isolated error].

हिन्दी अर्थ

विषम राशि में सप्तमांश (D-7) के स्वामी उस राशि के अपने स्वामी से गिने जाते हैं। सम राशि में, इसके विपरीत, सप्तम राशि के स्वामी से आगे गिनकर जाने जाते हैं [स्पष्टीकरण: मुद्रित पाठ में "सप्तमक्षादि" है, जिसमें "सप्तमर्क्षादि" (सप्तम+ऋक्षादि के सन्धि-नियम से अपेक्षित रूप) का रेफ नहीं है -- यही प्रवृत्ति श्लोक ९ के "स्वक्षादि" में भी मिली थी, जिससे प्रतीत होता है कि यह इस मुद्रित संस्करण की एक सुसंगत वर्तनी-शैली है, पृथक् त्रुटि नहीं]।

स्रोत: BPHS Ch.6, verse 10, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.73 (printed page 41, chapter header "षोडशवर्गवर्णनाध्यायः"), read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p73-v10.png) confirming the printed text letter-by-letter. Directly corroborated by the page's own Hindi prose commentary immediately below verses 10-11 ("mesh, mithun aadi visham raashiyon mein raashiish se 7 raashiyon ke adhip, aur vrish, kark aadi sam raashiyon mein raashi ke saptamesh se aage 7 raashiyon ke adhip saptamaanshesh hote hain"), and by a worked example and a full "स्पष्टार्थ सप्तमांशचक्र" table on the same page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

क्षारक्षीरौ च दध्याज्यौ तथेक्षुरससम्भवः । मधशुद्धजलावोजे समे शुद्धजलादिकाः ॥ ११ ॥

kshaarakshiirau cha dadhyaajyau tathekshurasasambhavah | madhashuddhajalaavoje same shuddhajalaadikaah || 11 ||

अंग्रेज़ी अर्थ

[The seven Saptamamsha divisions are named, in sequence, after:] salt-water and milk (kshaara-kshiirau), curd and ghee (dadhi-aajyau), and likewise (tathaa) that born of sugarcane-juice (ikshu-rasa-sambhavah), honey, [and] pure water (madhu-shuddhajala) -- in an odd sign (oje) [DISCLOSED: the compound "madhashuddhajalaavoje" printed here is not fully resolved letter-for-letter into standard word-boundaries -- it is transcribed exactly as printed, with the intended sense ("honey [and] pure water, in an odd sign") taken from the page's own prose restatement of the full seven-item list]; in an even (same) sign, [the same seven divisions are named] beginning with pure water [i.e. in the reverse order, per the page's own commentary, which explicitly restates the odd-sign order as Chara/Kshira/Dadhi/Ajya/Ikshurasa/Madhu/Shuddhajala and the even-sign order as its exact reverse -- note the commentary's first item, "chaara", appears to diverge slightly from the verse's own "kshaara" (salt), a minor variance disclosed rather than silently reconciled].

हिन्दी अर्थ

[सप्तमांश की सात राशियाँ क्रमशः इन पदार्थों के नाम से जानी जाती हैं:] क्षार तथा क्षीर, दधि तथा आज्य, तथा इक्षुरस से उत्पन्न, मधु, तथा शुद्धजल -- विषम राशि में [स्पष्टीकरण: मुद्रित संयुक्त पद "मधशुद्धजलावोजे" के शब्द-विभाजन को अक्षर-दर-अक्षर पूर्णतः स्पष्ट नहीं किया जा सका -- इसे जैसा मुद्रित है वैसा ही रखा गया है, तथा अभिप्रेत अर्थ ("मधु, शुद्धजल, विषम राशि में") पृष्ठ की अपनी गद्य-टीका के पूर्ण सात-पदार्थ सूची से लिया गया है]; सम राशि में यही सात भाग शुद्धजल से आरम्भ होकर (अर्थात् विपरीत क्रम में) कहे गए हैं [टीका में विषम-क्रम को चार, क्षीर, दधि, आज्य, इक्षुरस, मध, शुद्धजल तथा सम-क्रम को इसका ठीक उल्टा बताया गया है -- टीका के प्रथम पद "चार" तथा श्लोक के अपने "क्षार" में एक लघु अन्तर है, जिसे यहाँ बिना मिलाए खुला रखा गया है]।

स्रोत: BPHS Ch.6, verse 11, Kashi Sanskrit Series No.220, PDF p.73, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p73-v11.png, bphs-p73-v11-word.png) confirming the printed text letter-by-letter. The page's own Hindi commentary immediately below spells out the full seven-substance order for odd and even signs, and a worked example plus the "स्पष्टार्थ सप्तमांशचक्र" table (columns: चार, क्षीर, दधि, आज्य, इक्षुरस, मध, शुद्धजल) directly corroborate the substance list, though the table itself uses "चार" rather than the verse's "क्षार" for the first substance -- disclosed above rather than silently reconciled. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नवांशेशाश्चरे तस्मात् स्थिरे तन्नवमादितः ॥ उभये तत्पश्चमादे-रिति चिन्त्यं विचक्षणैः । देवा नृराक्षसाश्चैव चरादिषु गृहेषु च ॥ १२ ॥

navaanshesaashcharE tasmaat sthire tannavamaaditah || ubhaye tatpaschamaaderiti chintyam vichakshaNaih | devaa nriraakshasaashchaiva charaadishu griheshu cha || 12 ||

अंग्रेज़ी अर्थ

The lords of the Navamsha (D-9, navaamsheshaah): in a movable (chara) sign, [count] from that [sign] itself (tasmaat); in a fixed (sthira) sign, from its ninth (navama) onward (aaditah). In the dual/both-natured (ubhaye) [signs], from its fifth onward [DISCLOSED: the printed compound reads "tatpaschamaadeh", with "pascha" where "pancha" (fifth) is expected -- the identical substitution already disclosed and confirmed at verse 6.8's "sva-pascha-navamaanaam", now recurring here, further strengthening the case that this is a systematic spelling feature of this print edition] -- so it is to be reckoned (chintyam) by the discerning/wise (vichakshanaih). [These three categories of Navamsha lord are, respectively,] Devas (gods), Nara (men), and Rakshasas (demons), in the movable, [fixed, and dual] signs, respectively.

हिन्दी अर्थ

नवांश (D-9) के स्वामी: चर राशि में उसी राशि से; स्थिर राशि में उसके नवम से आगे [गिने जाते हैं]। उभय (द्विस्वभाव) राशियों में उसके पंचम से आगे [स्पष्टीकरण: मुद्रित संयुक्त पद में "पश्च" छपा है, जबकि अपेक्षित शब्द "पञ्च" है -- यह ठीक वही प्रतिस्थापन है जो श्लोक ६.८ के "स्वपश्चनवमानाम्" में पहले भी प्रकट व पुष्ट किया जा चुका है, अब यहाँ पुनः आने से यह प्रमाणित होता है कि यह इस मुद्रित संस्करण की एक व्यवस्थित वर्तनी-शैली है] -- ऐसा विद्वानों द्वारा माना जाना चाहिए। [ये तीन वर्ग क्रमशः] देव, नर (मनुष्य), तथा राक्षस हैं, क्रमशः चर, [स्थिर, तथा द्विस्वभाव] राशियों में।

स्रोत: BPHS Ch.6, verse 12 (a three-line unit: an unnumbered opening couplet-half followed by a numbered concluding line ॥१२॥, per the multi-line-unit convention already seen repeatedly in this text), Kashi Sanskrit Series No.220, PDF p.73, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p73-v12.png, bphs-p73-v12line3.png) confirming the printed text letter-by-letter. Opens the page's own "नवांश--" (Navamsha) subsection heading. The "pascha"-for-"pancha" substitution is a recurring-anomaly cross-corroboration with verse 6.8, now observed a second time. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ओजे स्वतो दिगंशाः स्युर्युग्मे तन्नवमान्मताः । पूर्वादिदश दिक्पाला इन्द्राग्नियमराक्षसाः ॥ १३ ॥

oje svato diganshaah syuryugme tannavamaanmataah | puurvaadidasha dikpaalaa indraagniyamaraakshasaah || 13 ||

अंग्रेज़ी अर्थ

In an odd (oje) sign, the directional-portions (dig-anshaah, i.e. the Dashamsha, D-10 divisions) are [counted] from that [sign] itself (svatah); in an even (yugme) sign, they are held (mataah) [to be counted] from its ninth (navamaat). The ten regents of the directions (dikpaalaah), beginning from the east (puurva-aadi, i.e. in sequence starting from Indra, lord of the east), are: Indra, Agni, Yama, [and] Rakshasa [Nirriti].

हिन्दी अर्थ

विषम राशि में दिगंश (दशमांश, D-10) उसी राशि से [गिने जाते हैं]; सम राशि में वे उसके नवम राशि से [गिने जाने चाहिए] ऐसा माना गया है। पूर्व आदि दस दिक्पाल क्रमशः इन्द्र, अग्नि, यम, तथा राक्षस (निर्ऋति) हैं।

स्रोत: BPHS Ch.6, verse 13, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.75 (printed page 43, chapter header "षोडशवर्गवर्णनाध्यायः"), read from a clean 600dpi full-page render and a direct zoom crop (scratchpad/bphs-p75-v13-14.png) confirming the printed text letter-by-letter. Directly corroborated by the page's own Hindi prose commentary ("visham raashiyon mein usii raashi se aarambh kar dash raashiyon ke aur sam raashiyon mein usse navam raashi se aarambh kar dash raashiyon ke dashmaansh hote hain. Purv aadi dash dikpaal kramashah Indra, Agni, Yam, Raakshas, Varun, Maarut, Kuver, Iishaan, Brahmaa, Anant in naamon se prasiddh hain") and by a worked example and a full "स्पष्टार्थ दशमांशचक्र" table on the same page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वरुणो मारुतश्चैव कुवेरेशानपद्मजाः । अनन्ताश्च क्रमादोजे समे वा व्युत्क्रमेण तु ॥ १४ ॥

varuNo maarutashchaiva kuvereshaanapadmajaah | anantaashcha kramaadoje same vaa vyutkrameNa tu || 14 ||

अंग्रेज़ी अर्थ

Varuna, Maruta (Vayu), and likewise (cha eva) Kuvera, Ishana, Padmaja (Brahma, "lotus-born"), and Ananta [complete the ten regents]. [These ten are to be applied] in due sequence (kramaat) for an odd (oje) sign; for an even (same) sign, however (tu), in reverse order (vyutkrameNa).

हिन्दी अर्थ

वरुण, मारुत (वायु), तथा इसी प्रकार कुवेर, ईशान, पद्मज (ब्रह्मा, "कमल से उत्पन्न"), तथा अनन्त [शेष छह दिक्पाल हैं, जो दशमांश के दस दिक्पालों को पूर्ण करते हैं]। विषम राशि में इन्हें क्रमशः, तथा सम राशि में इसके विपरीत क्रम (व्युत्क्रम) से समझना चाहिए।

स्रोत: BPHS Ch.6, verse 14, Kashi Sanskrit Series No.220, PDF p.75, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p75-v13-14.png, bphs-p75-v14line2.png) confirming the printed text letter-by-letter. Combined citation "॥१३-१४॥" closes the page's Hindi prose commentary on both verses together. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्वादशाशस्य गणनां तत्तत्क्षेत्राद् विनिर्दिशेत् । तेषामधीशाः क्रमशो गणेशाश्वियमाहयः ॥ १५ ॥

dvaadashaashasya gananaam tattatkshetraad vinirdishet | teshaamadhiishaah kramasho ganeshaashviyamaahayah || 15 ||

अंग्रेज़ी अर्थ

One should specify (vinirdishet) the reckoning (gananaam) of the Dwadashamsha (D-12) [DISCLOSED: the printed compound reads "dvaadashaashasya", lacking the anusvara expected in the standard classical form "dvaadashaamshasya" (dvaadasha-amsha-sya, "of the twelfth-division"); a dedicated zoom crop confirmed no anusvara dot is printed, so it is transcribed exactly as printed] from that same (tattat) sign (kshetraat) [i.e., always beginning the count from the sign itself, for whichever sign is under consideration]. Their (teshaam) lords (adhiishaah), in due sequence (kramashah), are Ganesha, Ashvi (Ashwinikumara), Yama, [and] Ahi (the serpent, i.e. Sarpa) [these four repeating three times across the twelve signs].

हिन्दी अर्थ

द्वादशांश (D-12) की गणना उसी-उसी राशि से ही बतानी चाहिए [स्पष्टीकरण: मुद्रित पाठ में "द्वादशाशस्य" छपा है, जिसमें मानक पारम्परिक रूप "द्वादशांशस्य" में अपेक्षित अनुस्वार नहीं है; एक विशेष ज़ूम से पुष्टि हुई कि कोई अनुस्वार बिन्दु मुद्रित नहीं है, अतः जैसा छपा है वैसा ही रखा गया है] (अर्थात् विचारणीय राशि से ही आरम्भ करके गिनना चाहिए)। उनके अधीश क्रमशः गणेश, अश्वि (अश्विनीकुमार), यम, तथा अहि (सर्प) हैं [ये चार बारह राशियों में तीन बार आवृत्त होते हैं]।

स्रोत: BPHS Ch.6, verse 15, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.76 (printed page 44, chapter header "बृहत्पाराशरहोराशास्त्रम्"), read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p76-v15b.png, bphs-p76-v15-w1.png through bphs-p76-v15-w6.png) confirming the printed text letter-by-letter, including a dedicated zoom establishing the absence of an anusvara in "dvaadashaashasya" and a dedicated zoom confirming the repha is correctly present in "vinirdishet" (unlike the dropped-repha pattern seen elsewhere in this edition). Opens immediately below the page's own "द्वादशांश--" (Dwadashamsha) subsection heading. Directly corroborated by the page's own Hindi prose commentary ("dvaadashaansh kii gananaa vichaaraniiy raashi se hii aarambh kar kramashah 12 raashiyon ke dvaadashaansh hote hain. Unke adhiish Ganesh, Ashvinikumaar, Yam, Sarp ye chaar tiin aavritti se hote hain"), a worked example, and a full "स्पष्टार्थ द्वादशांशचक्र" table with the rows Ganesha/Ashwinikumara/Yama/Sarpa repeating three times across the twelve signs. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अजसिंहाश्रितो ज्ञेया नृपांशाश्वरभादिषु । अज-विष्णू हरः सूर्यो ह्योजे युग्मे प्रतीपकम् ॥ १६ ॥

ajasinhaashrito jneyaa nripaanshaashvarabhaadishu | aja-vishnuu harah suuryo hyoje yugme pratiipakam || 16 ||

अंग्रेज़ी अर्थ

The Nripamsha ("king-portion", i.e. the Shodashamsha, D-16) is to be known (jneyaa) as resting upon (aashritah) [the signs] Aja ("goat", Mesha/Aries) [and] Simha (Lion, Leo) [DISCLOSED: the page's own commentary clarifies that the reckoning begins from Mesha, Simha, or Dhanu according to whether the sign under consideration is chara/movable, sthira/fixed, or dvisvabhava/dual respectively; the verse compresses this into "ajasinhaashritah" naming only the first two starting-points explicitly, with the third (Dhanu, for dual signs) evidently implied by the following compound] ... in [the movable, fixed, and dual signs] [DISCLOSED: the printed compound reads "nripaanshaashvarabhaadishu" -- its word-boundaries are not fully resolved letter-for-letter; a dedicated zoom crop confirmed the akshara sequence "-shva-ra-bhaa-" (not the more expected "-shcha-ra-" for "chara"), so it is transcribed exactly as printed rather than silently normalized to the expected classical wording, with the intended sense (chara/sthira/dvisvabhava signs) taken from the page's own prose restatement]. Aja (Brahma, "the unborn"), Vishnu, Hara (Shiva), [and] Surya (the Sun) -- [these four, in this order,] indeed (hi) [are the lords] in an odd (oje) [sign, and] in an even (yugme) [sign, the order is] reversed (pratiipakam).

हिन्दी अर्थ

नृपांश (राजांश, अर्थात् षोडशांश, D-16) को अज (मेष) तथा सिंह पर आश्रित जानना चाहिए [स्पष्टीकरण: पृष्ठ की अपनी टीका स्पष्ट करती है कि चर, स्थिर, द्विस्वभाव राशि होने के अनुसार क्रमशः मेष, सिंह, अथवा धनु से गणना आरम्भ होती है; श्लोक "अजसिंहाश्रितो" में केवल प्रथम दो आरम्भ-बिन्दु (मेष, सिंह) स्पष्ट कहे गए हैं, तीसरा (द्विस्वभाव के लिए धनु) आगे के संयुक्त पद में अन्तर्निहित प्रतीत होता है] ... चर, स्थिर, द्विस्वभाव राशियों में [स्पष्टीकरण: मुद्रित संयुक्त पद "नृपांशाश्वरभादिषु" है, जिसके शब्द-विभाजन को अक्षर-दर-अक्षर पूर्णतः स्पष्ट नहीं किया जा सका; एक विशेष ज़ूम से "-श्व-र-भा-" अक्षर-क्रम की पुष्टि हुई (अपेक्षित "-श्च-र-", अर्थात् "चर", के स्थान पर), अतः जैसा मुद्रित है वैसा ही रखा गया है, तथा अभिप्रेत अर्थ (चर, स्थिर, द्विस्वभाव राशियाँ) पृष्ठ की अपनी गद्य-टीका से लिया गया है]। अज (ब्रह्मा), विष्णु, हर (शिव), तथा सूर्य -- ये चार, इसी क्रम में, विषम राशि में होते हैं; सम राशि में यह क्रम उलट जाता है।

स्रोत: BPHS Ch.6, verse 16, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.77 (printed page 45, chapter header "षोडशवर्गवर्णनाध्यायः"), read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p77-v16.png, bphs-p77-v16-w1.png, bphs-p77-v16-w4.png, bphs-p77-v16-line2.png) confirming the printed text letter-by-letter, including a dedicated zoom establishing the akshara sequence in the disputed compound "nripaanshaashvarabhaadishu" (compared directly against an unambiguous "cha" glyph elsewhere on the same page, in "kriyaachare" of verse 17, to rule out a font-legibility misread) and a sandhi resolution of "suuryo hyoje" (suuryah + hi + oje) confirmed against the page's own commentary. Opens the page's own "षोडशांश--" (Shodashamsha) subsection heading. Directly corroborated by the page's own Hindi prose commentary ("char, sthir, dvisvabhaav raashiyon mein kramashah mesh, sinh, dhanu se aarambh kar shodashaansh samajhnaa chaahiye. Brahmaa, Vishnu, Shiv, Suury, visham raashiyon mein kram se, aur sam-raashiyon mein utkram se chaar aavritti mein un shodashaanshon ke adhip hote hain"), a worked example, and a full "स्पष्टार्थ षोडशांशचक्र" table on the same page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ विंशतिभागानामधिपा ब्रह्मणोदिताः । क्रियाचरे स्थिरे चापान् मृगेन्द्राद् द्विस्वभावके ॥ १७ ॥

atha vinshatibhaaganaamadhipaa brahmaNoditaah | kriyaachare sthire chaapaan mrigendraad dvisvabhaavake || 17 ||

अंग्रेज़ी अर्थ

Now (atha), the lords of the twenty divisions (vinshati-bhaaganaam, the Vimshamsha, D-20) are declared (uditaah) by Brahma. In the Chara (movable) [sign], [the count begins] from Kriya (Aries) itself; in the Sthira (fixed) [sign], from Chapa (Dhanu/Sagittarius); [and] in the Dvisvabhava (dual) [sign], from Mrigendra (Simha/Leo, "lord of beasts") [DISCLOSED: the verse's compressed word-order places "chaapaat" and "mrigendraat" consecutively before "dvisvabhaavake", so the pairing of each starting-sign with its sign-quality category is inferred from adjacency and from the parallel structure of the Dreshkana/Chaturthamsha counting rules given earlier in this chapter, rather than stated in fully unambiguous prose].

हिन्दी अर्थ

अब (अथ) विंशति भागों (विंशांश, D-20) के अधिप ब्रह्मा द्वारा कहे गए हैं। चर राशि में क्रिया (मेष) से ही [गणना आरम्भ होती है]; स्थिर राशि में चाप (धनु) से; तथा द्विस्वभाव राशि में मृगेन्द्र (सिंह, "पशुओं का स्वामी") से [स्पष्टीकरण: श्लोक के संक्षिप्त शब्द-क्रम में "चापात्" तथा "मृगेन्द्रात्" द्विस्वभावके से ठीक पहले लगातार आते हैं, अतः प्रत्येक आरम्भ-राशि का सम्बन्धित राशि-वर्ग से मेल निकटता तथा इस अध्याय में पूर्व वर्णित द्रेष्काण/चतुर्थांश गणना-नियमों की समरूपता के आधार पर अनुमानित है, न कि पूर्णतः असंदिग्ध गद्य से]।

स्रोत: BPHS Ch.6, verse 17, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.77 (printed page 45, chapter header "षोडशवर्गवर्णनाध्यायः"), read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p77-v17-compare2.png, bphs-p77-v17-line2.png) confirming the printed text letter-by-letter. Opens the page's own "विंशांश--" (Vimshamsha) subsection heading. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

काली गौरी जया लक्ष्मीविजया विमला सती । तारा ज्वालामुखी श्वेता ललिता बगलामुखी ॥ १८ ॥

kaalii gaurii jayaa lakshmiivijayaa vimalaa satii | taaraa jvaalaamukhii shvetaa lalitaa bagalaamukhii || 18 ||

अंग्रेज़ी अर्थ

Kali, Gauri, Jaya, Lakshmi-Vijaya, Vimala, Sati [DISCLOSED: the printed first name reads "kaanlii", with an anusvara before the long "ii" that is not present in the well-known goddess-name "Kaalii"; transcribed here as "Kaalii" on the strength of the universally attested name, with the printed anusvara noted as a probable print artifact], Tara, Jvalamukhi, Shveta, Lalita, [and] Bagalamukhi -- [these ten being among] the twenty [presiding deities of the Vimshamsha, D-20, continued in the next verse].

हिन्दी अर्थ

काली, गौरी, जया, लक्ष्मी-विजया, विमला, सती [स्पष्टीकरण: मुद्रित पहले नाम में "कां" के रूप में एक अनुस्वार छपा है, जो सुप्रसिद्ध देवी-नाम "काली" में नहीं होता; यहाँ सर्वमान्य नाम "काली" के आधार पर पढ़ा गया है, तथा मुद्रित अनुस्वार को सम्भवतः मुद्रण-दोष माना गया है], तारा, ज्वालामुखी, श्वेता, ललिता, तथा बगलामुखी -- [ये दस, विंशांश (D-20) के बीस अधिष्ठात्री देवियों में से हैं, अगले श्लोक में शेष जारी]।

स्रोत: BPHS Ch.6, verse 18, Kashi Sanskrit Series No.220, PDF p.77, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p77-v18-line1.png, bphs-p77-v18-w1.png, bphs-p77-v18-w2.png, bphs-p77-v18-w3.png) confirming the printed text letter-by-letter, including a dedicated zoom establishing the anusvara present in the printed "kaanlii". This ten-name sequence matches the first half of the well-attested twenty-name Vimshamsha deity list. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्रत्यङ्गिरा शची रौद्री भवानी वरदा जया । त्रिपुरा सुमुखी चेति विषमे परिचिन्तयेत् ॥ १९ ॥

pratyangiraa shachii raudrii bhavaanii varadaa jayaa | tripuraa sumukhii cheti vishame parichintayet || 19 ||

अंग्रेज़ी अर्थ

Pratyangira, Shachi, Raudri, Bhavani, Varada, Jaya, Tripura, [and] Sumukhi -- thus (iti) [named, completing the twenty presiding deities of the Vimshamsha, D-20]. [These] should be reckoned/assigned (parichintayet) in the odd (vishame) [sign, counted forward from the first name -- CORRECTION (confirming a disclosed reading): the next page's own prose commentary, closing verses 17-21 together, states explicitly "vishama raashiyon mein Kaali aadi aur samaraashiyon mein Dayaa, Medhaa aadi unakii svaaminii hotii hain" ("in odd signs, Kali etc.; in even signs, Daya, Medha etc. are their [Vimshamsha] lords") -- confirming "vishame" (odd sign) was indeed the correct printed reading, not "vinshe" as this verse's entry once weighed as more contextually plausible. The even-sign counterpart, previously noted here as not yet found, is now confirmed: it is given explicitly in verses 20-21].

हिन्दी अर्थ

प्रत्यङ्गिरा, शची, रौद्री, भवानी, वरदा, जया, त्रिपुरा, तथा सुमुखी -- इस प्रकार [नामित, विंशांश (D-20) के बीस अधिष्ठात्री देवियों को पूर्ण करते हुए]। इन्हें विषम राशि में [आगे की ओर, प्रथम नाम से गिनकर, इस प्रकार समझा जाना चाहिए -- सुधार (एक पूर्व-प्रकट पाठ की पुष्टि): अगले पृष्ठ की अपनी गद्य-टीका, जो श्लोक १७-२१ को एक साथ समेटती है, स्पष्ट कहती है -- "विषम राशियों में काली आदि और समराशियों में दया, मेधा आदि उनकी स्वामिनी होती हैं" -- जिससे पुष्टि होती है कि "विषमे" (विषम राशि) ही सही मुद्रित पाठ था, न कि "विंशे" जिसे इस श्लोक की प्रविष्टि में पहले प्रसंग की दृष्टि से अधिक उपयुक्त माना गया था। सम-राशि का सम्बन्धित नियम, जिसे पहले "अभी तक नहीं मिला" कहा गया था, अब श्लोक २०-२१ में स्पष्ट रूप से मिल गया है] गिनकर लगाना चाहिए।

स्रोत: BPHS Ch.6, verse 19 (closing the Vimshamsha's 20-name deity list begun in verse 18), Kashi Sanskrit Series No.220, PDF p.77, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p77-v19-w1.png, bphs-p77-v19-w2.png, bphs-p77-v19-w3.png, bphs-p77-v19-w4.png, bphs-p77-v19-w5.png, bphs-p77-v19-line2b.png) confirming the printed text letter-by-letter, including a dedicated zoom establishing that the word before "parichintayet" reads "vishame" (via the retroflex sha/"ष" akshara, three clear aksharas वि-ष-मे) rather than "vinshe" ("in the Vimshamsha", which would require only two aksharas with an anusvara and palatal sha). This eighteen-plus-two name sequence, combined with verse 18's ten names, matches the well-attested twenty-name Vimshamsha deity list. CORRECTION note added after reading PDF p.78 (printed page 46): the page's own prose commentary closing verses 17-21 ("chara raashiyon mein Mesh se, sthir raashiyon mein Dhanu se aur dvisvabhaav raashiyon mein Sinh se aarambhkar Vinshaansh kii gananaa hotii hai. Visham raashiyon mein Kaalii aadi aur samaraashiyon mein Dayaa, Medhaa aadi unakii svaaminii hotii hain") and the full 20-row "स्पष्टार्थ विंशांशचक्र" table (columns सं./वि.स्वा. for the odd-sign names of verses 18-19, स.स्वा. for the even-sign names of verses 20-21) directly confirm the "vishame" reading. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

समराशौ दया मेधा छिन्नशीर्षा पिशाचिनी । धूमावती च मातङ्गी वाला भद्रा रुणाऽनला ॥ २० ॥

samaraashau dayaa medhaa chhinnashiirshaa pishaachinii | dhuumaavatii cha maatangii vaalaa bhadraa runaa'nalaa || 20 ||

अंग्रेज़ी अर्थ

In an even (sama) sign, [the twenty Vimshamsha lords are] Daya, Medha, Chhinnashirsha, Pishachini, Dhumavati, and (cha) Matangi, Vala (Bala), Bhadra, Runa [DISCLOSED: the printed text reads "runaa", lacking the initial "a" of the expected classical name "Aruna"/"Aruna" -- the page's own tabulated Vimshamsha-chakra restores the full form "Aruna" for this same position, so the verse's spelling is transcribed exactly as printed rather than silently completed] [and] Anala (joined by sandhi as "runaa'nalaa", with an avagraha marking the elided "a" of "analaa") -- [these ten being the first half of the twenty deities presiding over the Vimshamsha in an even sign, matching the odd-sign list of verses 18-19 name-for-name in the same serial order, per the page's own commentary and its full 20-row Vimshamsha-chakra table].

हिन्दी अर्थ

सम राशि में [विंशांश के बीस स्वामी हैं] दया, मेधा, छिन्नशीर्षा, पिशाचिनी, धूमावती, तथा मातङ्गी, वाला (बाला), भद्रा, रुणा [स्पष्टीकरण: मुद्रित पाठ में "रुणा" है, जिसमें अपेक्षित पारम्परिक नाम "अरुणा" का आरम्भिक "अ" नहीं है -- पृष्ठ की अपनी विंशांशचक्र तालिका इसी स्थान के लिए पूर्ण रूप "अरुणा" देती है, अतः श्लोक की वर्तनी जैसी छपी है वैसी ही रखी गई है, स्वतः पूर्ण नहीं की गई है], तथा अनला (सन्धि से "रुणाऽनला", जिसमें अवग्रह "अनला" के लुप्त "अ" को दर्शाता है) -- [ये दस, सम राशि में विंशांश के अधिष्ठाता बीस देवियों में से पहली दस हैं, जो पृष्ठ की अपनी टीका तथा सम्पूर्ण बीस-पंक्ति विंशांशचक्र तालिका के अनुसार श्लोक १८-१९ की विषम-राशि सूची से क्रमशः नाम-दर-नाम मेल खाती हैं]।

स्रोत: BPHS Ch.6, verse 20, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.78 (printed page 46, chapter header "बृहत्पाराशरहोराशास्त्रम्"), read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p78-v20-21.png, bphs-p78-v20-runa.png, bphs-p78-v20-matangi.png) confirming the printed text letter-by-letter, including a dedicated zoom establishing the missing initial "a" in "runaa" (for expected "Arunaa") and confirming the clean reading of "maatangii". Directly corroborated by the page's own Hindi prose commentary closing verses 17-21 together ("chara raashiyon mein Mesh se, sthir raashiyon mein Dhanu se aur dvisvabhaav raashiyon mein Sinh se aarambhkar Vinshaansh kii gananaa hotii hai. Visham raashiyon mein Kaalii aadi aur samaraashiyon mein Dayaa, Medhaa aadi unakii svaaminii hotii hain"), a worked example, and a full 20-row "स्पष्टार्थ विंशांशचक्र" table (column स.स्वा., listing Daya/Medha/Chhinnashirsha/Pishachi/Dhumavati/Matangi/Vala/Bhadra/Aruna/Anala for rows 1-10). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पिङ्गला छुच्छुका घोरा वाराही वैष्णवी सिता । भुवनेशी भैरवी च मङ्गला व्यपराजिता ॥ २१ ॥

pingalaa chhuchchhukaa ghoraa vaaraahii vaishnavii sitaa | bhuvaneshii bhairavii cha mangalaa vyaparaajitaa || 21 ||

अंग्रेज़ी अर्थ

Pingala, Chuchchhuka, Ghora, Varahi, Vaishnavi, Sita, Bhuvaneshi, Bhairavi, and (cha) Mangala, [and] Vyaparajita [DISCLOSED: the printed name here reads "vyaparaajitaa", with an extra "vya-" prefix not present in the expected classical name "Aparajita" (also matching the page's own table, which abbreviates this last entry as "aparaaji."); transcribed exactly as printed rather than silently normalized] -- [completing, together with verse 20's ten names, the twenty deities presiding over the Vimshamsha in an even sign]. [This closes the page's own combined commentary on verses 17-21, and its full Vimshamsha-chakra table.]

हिन्दी अर्थ

पिङ्गला, छुच्छुका, घोरा, वाराही, वैष्णवी, सिता, भुवनेशी, भैरवी, तथा मङ्गला, व्यपराजिता [स्पष्टीकरण: यहाँ मुद्रित नाम "व्यपराजिता" है, जिसमें अपेक्षित पारम्परिक नाम "अपराजिता" में न मिलने वाला अतिरिक्त "व्य-" उपसर्ग है (पृष्ठ की अपनी तालिका भी इस अन्तिम प्रविष्टि को संक्षेप में "अपराजि." लिखती है); जैसा मुद्रित है वैसा ही रखा गया है, स्वतः सामान्य नहीं किया गया] -- [श्लोक २० के दस नामों के साथ मिलकर, सम राशि में विंशांश के अधिष्ठाता बीस देवियों को पूर्ण करते हुए]। [यहीं पृष्ठ की श्लोक १७-२१ की संयुक्त टीका तथा इसकी विंशांशचक्र तालिका समाप्त होती है।]

स्रोत: BPHS Ch.6, verse 21, Kashi Sanskrit Series No.220, PDF p.78, read from a clean 600dpi full-page render and direct zoom crops (scratchpad/bphs-p78-v21-l.png, bphs-p78-v21-r.png, bphs-p78-v21-bhuvaneshi2.png, bphs-p78-v21-aparajita.png) confirming the printed text letter-by-letter, including a dedicated zoom establishing the clean "bhuvaneshii" reading (ruling out a possible "bhavaneshii" misread) and a dedicated zoom establishing the extra "vya-" prefix on "vyaparaajitaa" against the table's abbreviated "aparaaji.". The full 20-row "स्पष्टार्थ विंशांशचक्र" table (column स.स्वा., rows 11-20) directly corroborates this name sequence. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सिद्धांशकानामधिपाः सिंहादोजभगे ग्रहे । कर्कादियुग्मभगे खेटे स्कन्दः पशुधरोऽनलः ॥ २२ ॥

siddhaanshakaanaamadhipaah sinhaadojabhage grahe | karkaadiyugmabhage khete skandah pashudharo'nalah || 22 ||

अंग्रेज़ी अर्थ

The lords of the Siddhamshaka (the Chaturvimshamsha, D-24) [are now declared]: for a planet (grahe) situated in an odd (oja) sign, [the count begins] from Simha (Leo); for a planet (khete) situated in an even (yugma) sign, [the count begins] from Karka (Cancer). [The list of lords opens with] Skanda, Pashudhara, [and] Anala (Agni) [DISCLOSED: this verse's second line, obscured on the source page by a bottom-of-page watermark overlapping the ink, was recovered by extracting the underlying watermark-free scan image directly from the PDF (bypassing the watermark, which is a separate text layer rendered over the scan rather than part of it) and re-cropping from that clean image; the three names "Skandah", "Pashudharah", and "Analah" are clearly legible in this clean crop as the opening of the Chaturvimshamsha's 24-name lord-list, but their exact correspondence to specific count-positions (first/second/third of twenty-four) is not yet confirmed, and the list evidently continues into the following verse(s), not yet transcribed]. CONFIRMATION (from the next page's own chakra table): the next page's full 24-row "चतुर्विंशांशचक्र" table lists these same three names as rows 1-3 of the odd-sign (विप.स्वा.) column in this exact order -- Skanda, [Pashudhara], Anala -- confirming both the reading and the count-position; the table's row-2 cell for this name appears to carry an anusvara ("पशुंधरः"), but the same name recurs without one at the table's own row 23 ("पशुधरः", even-sign column) -- given this internal inconsistency within a single table, the row-2 mark is judged more likely a print/scan artifact than a genuine anusvara, and the verse's own "पशुधरः" (no anusvara, matching row 23) is kept as the transcription, with the discrepancy disclosed rather than silently resolved.

हिन्दी अर्थ

सिद्धांशक (चतुर्विंशांश, D-24) के अधिप अब कहे जाते हैं: विषम राशि में स्थित ग्रह के लिए सिंह से गणना आरम्भ होती है; सम राशि में स्थित ग्रह (खेट) के लिए कर्क से गणना आरम्भ होती है। [अधिपों की सूची आरम्भ होती है] स्कन्द, पशुधर, तथा अनल (अग्नि) से [स्पष्टीकरण: इस श्लोक की दूसरी पंक्ति, जो मूल पृष्ठ पर पृष्ठ के निचले भाग के जलचिह्न (वॉटरमार्क) से स्याही के ऊपर ढकी हुई थी, को पीडीएफ़ से सीधे अंतर्निहित जलचिह्न-रहित मूल स्कैन-चित्र निकालकर (जलचिह्न, जो स्कैन का भाग नहीं बल्कि उसके ऊपर रखी एक पृथक् पाठ-परत है, को दरकिनार करते हुए) और उसी स्वच्छ चित्र से पुनः क्रॉप करके स्पष्ट किया गया; इस स्वच्छ क्रॉप में "स्कन्दः", "पशुधरः", तथा "अनलः" नाम स्पष्ट रूप से चतुर्विंशांश की चौबीस-नाम अधिप-सूची के आरम्भ के रूप में पढ़े जाते हैं, परन्तु इनका किस-किस गिनती-स्थान (चौबीस में से पहला/दूसरा/तीसरा) से ठीक-ठीक मेल है यह अभी स्पष्ट नहीं है, और यह सूची अगले श्लोक(श्लोकों) में जारी प्रतीत होती है, जो अभी लिप्यंतरित नहीं हुई]। [पुष्टिः: अगले पृष्ठ की सम्पूर्ण चौबीस-पंक्ति "चतुर्विंशांशचक्र" तालिका विषम-राशि (विप.स्वा.) स्तम्भ की पहली तीन पंक्तियों में ठीक इसी क्रम में स्कन्द, पशुंधर, अनल नाम देती है, जिससे पाठ तथा गिनती-स्थान दोनों की पुष्टि होती है; तालिका की पंक्ति 2 में इस नाम पर अनुस्वार जैसा चिह्न दिखता है ("पशुंधरः"), परन्तु वही नाम तालिका की अपनी पंक्ति 23 (सम-राशि स्तम्भ) में बिना अनुस्वार के "पशुधरः" फिर आता है -- एक ही तालिका के भीतर यह असंगति देखते हुए, पंक्ति 2 का चिह्न वास्तविक अनुस्वार की अपेक्षा मुद्रण/स्कैन-दोष अधिक सम्भावित माना गया है, अतः श्लोक की अपनी वर्तनी "पशुधरः" (बिना अनुस्वार, पंक्ति 23 से मेल खाती) ही लिप्यंतरण में रखी गई है, तथा यह असंगति स्वतः सुलझाए बिना यहाँ स्पष्ट की गई है]।

स्रोत: BPHS Ch.6, verse 22 (opening the "चतुर्विंशांश" [Chaturvimshamsha, D-24] subsection, immediately following the Vimshamsha's closing commentary and table on the same page), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.78 (printed page 46). Line 1 read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p78-v22-line1.png and its left/right splits), confirming "सिद्धांशकानामधिपाः सिंहादोजभगे ग्रहे ।" letter-by-letter. Line 2 was obscured in every crop taken from the standard render (scratchpad/bphs-p78-v22-line2a.png, -line2b.png, -line2c.png, and a failed brightness-threshold experiment -line2-thresh.png, since the watermark ink and the true text ink proved equally dark) by the page's "CC-0. Swami Atmanand Giri (Prabhuji). Veda Nidhi Varanasi. Digitized by eGangotri" watermark; this was traced (via page.get_text(), which returned only the watermark string and no Devanagari) to the watermark being a distinct PDF text-layer object composited over the page rather than part of the scanned image. The embedded scan itself was recovered watermark-free by extracting its raw JPEG XObject directly (page.get_images(full=True) + doc.extract_image(xref), xref 231, saved as scratchpad/bphs-p78-raw.jpg), after mapping crop coordinates from the standard render into the raw image's own pixel space via its placement rectangle (page.get_image_rects). Clean crops from this raw image (scratchpad/bphs-p78-v22-clean.png confirming the line's ending "...स्कन्दः पशुधरोऽनलः ॥ २२ ॥"; scratchpad/bphs-p78-v22-clean-left.png and bphs-p78-v22-full2.png confirming the middle portion "कर्कादियुग्मभगे खेटे स्कन्...") together establish line 2 as transcribed above. This watermark-bypass technique (raw embedded-image extraction) should be applied proactively to any future page in this PDF where similar bottom-of-page watermark overlap is suspected. CONFIRMATION added after reading PDF p.79 (printed page 47): its full 24-row "चतुर्विंशांशचक्र" table (column विप.स्वा., rows 1-3, zoom crop scratchpad/bphs-p79-table-rows1-3.png) lists Skanda / Pashudhara / Anala in this exact order, confirming this verse's opening three lords and their count-positions; row 2 of that same crop appears to carry a stray anusvara on this name ("पशुंधरः"), but the table's own row 23 (even-sign column, zoom crop scratchpad/bphs-p79-v24b-heading.png) repeats the name without one ("पशुधरः"), so the anusvara is judged a probable print/scan artifact rather than a genuine spelling and this verse's anusvara-free reading is retained. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विश्वकर्मा भगो मित्रो मयाऽन्तकवृषध्वजाः । गोविन्दो मदनो भीमः सिंहादौ विषमे क्रमात् ॥ २३ ॥

vishvakarmaa bhago mitro mayaa'ntakavrishadhvajaah | govindo madano bhiimah sinhaadau vishame kramaat || 23 ||

अंग्रेज़ी अर्थ

Vishvakarma, Bhaga, Mitra, Maya, [and] (joined by sandhi as "mayaa'ntaka", with an avagraha marking the elided initial "a" of "antaka") Antaka, Vrishadhvaja, Govinda, Madana, [and] Bhima -- [these, continuing directly from verse 22's Skanda, Pashudhara, and Anala, complete the twelve-name cycle (repeated twice over for the Chaturvimshamsha's full twenty-four divisions)], in due order (kramaat), for an odd (vishame) [sign], starting from (aadau) Simha (Leo).

हिन्दी अर्थ

विश्वकर्मा, भग, मित्र, मय, तथा (सन्धि से "मयाऽन्तक", जिसमें अवग्रह "अन्तक" के लुप्त आरम्भिक "अ" को दर्शाता है) अन्तक, वृषध्वज, गोविन्द, मदन, तथा भीम -- [ये, श्लोक २२ के स्कन्द, पशुधर, तथा अनल से आगे बढ़ते हुए, चतुर्विंशांश के पूर्ण चौबीस भागों के लिए दो बार आवृत्त होने वाले बारह-नाम चक्र को पूर्ण करते हैं], विषम राशि में सिंह से आरम्भ करके, क्रमशः।

स्रोत: BPHS Ch.6, verse 23, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.79 (printed page 47, chapter header "षोडशवर्गवर्णनाध्यायः"). This page carries no watermark overlap on its verse text (the watermark sits in the blank space below the page's final line), so read cleanly from a standard 600dpi full-page render and zoom crops (scratchpad/bphs-p79-v23-24.png, bphs-p79-v23-simhadau.png confirming the anusvara in "सिंहादौ"). Directly corroborated by the page's own full 24-row "चतुर्विंशांशचक्र" table (column विप.स्वा., rows 4-12: Vishvaka/Bhaga/Mitra/Maya/Antaka/Vrishadhvaja/Govinda/Madana/Bhima) and its prose commentary ("vipam raashiyon mein Sinh se aur samaraashiyon mein Karkaadi kram se gin kar Chaturvinshaansh samajhnaa chaahiye"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कर्कादौ सभभे भीमाद् विलोमेन विचिन्तयेत् । [भांश (सप्तविंशांश)—] भांशेशाः क्रमशो दस्त्रयमवह्निपितामहाः । चन्द्रेशादितिजीवाहि पितरोऽथ भगस्तथा ॥ २४ ॥

karkaadau sabhabhe bhiimaad vilomena vichintayet | [bhaansha (saptavinshaansha)--] bhaansheshaah kramasho dastrayamavahnipitaamahaah | chandreshaaditijiivaahi pitaro'tha bhagastathaa || 24 ||

अंग्रेज़ी अर्थ

For a [planet] in an even (sabhabhe) [sign], one should reckon (vichintayet) [the Chaturvimshamsha's lords] in reverse order (vilomena), starting from (aadau) Karka (Cancer), [beginning] from Bhima. [DISCLOSED: the source page prints a subsection heading, "Bhamsha (Saptavimshamsha)", immediately after this half-verse and before the text below, with no verse number appearing until after the following two lines -- so this entire block (the Chaturvimshamsha's even-sign rule plus the Bhamsha's opening names) shares a single printed verse number, "24"; it is kept as one entry here rather than split, to preserve that source peculiarity rather than silently assign it a number the page does not print.] The lords of the Bhamsha (Saptavimshamsha, D-27) are, in order (kramashah): Dasra (Ashwini Kumara), Yama, Vahni (Agni), [and] Pitamaha (Brahma); Chandra, Isha, Aditi, Jiva, [and] Ahi; [and] then (atha) Pitarah, [and] Bhaga likewise (tathaa) -- [these eleven names corresponding to the page's own 27-row Bhamsha-chakra table, rows 1 through 11].

हिन्दी अर्थ

सम राशि (सभभे) में [स्थित ग्रह] के लिए, कर्क से आरम्भ करके, भीम से विलोम (उल्टे) क्रम में [चतुर्विंशांश के अधिपों को] समझना चाहिए। [स्पष्टीकरण: मूल पृष्ठ पर इस अर्ध-श्लोक के ठीक बाद तथा नीचे के पाठ से पहले "भांश (सप्तविंशांश)" उपशीर्षक छपा है, और अगली दो पंक्तियों के बाद तक कोई नया श्लोक-क्रमांक नहीं आता -- अतः यह सम्पूर्ण खण्ड (चतुर्विंशांश का सम-राशि नियम तथा भांश के आरम्भिक नाम दोनों) एक ही मुद्रित श्लोक-क्रमांक "२४" साझा करता है; इस स्रोत-विशेषता को यथावत् रखने हेतु इसे यहाँ विभाजित करने के बजाय एक ही प्रविष्टि में रखा गया है, न कि पृष्ठ द्वारा न दिए गए किसी क्रमांक को स्वतः जोड़ा गया है।] भांश (सप्तविंशांश, D-27) के अधिप क्रमशः हैं: दस्त्र (अश्विनीकुमार), यम, वह्नि (अग्नि), तथा पितामह (ब्रह्मा); चन्द्र, ईश, अदिति, जीव, तथा अहि; तथा फिर पितर, तथा इसी प्रकार भग -- [ये ग्यारह नाम पृष्ठ की अपनी सत्ताईस-पंक्ति भांशचक्र तालिका की पंक्ति १ से ११ के अनुरूप हैं]।

स्रोत: BPHS Ch.6, a single printed verse numbered 24 spanning two topics (the Chaturvimshamsha's even-sign rule, then, after an inserted "भांश (सप्तविंशांश)—" subsection heading, the Bhamsha's opening eleven lords), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.79 (printed page 47), read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p79-v23-24.png, bphs-p79-bhamsha-verse.png, bphs-p79-bhamsha-line2.png, bphs-p79-bhamsha-word1b.png), confirming the printed text letter-by-letter, including the sandhi compounds "dastrayamavahnipitaamahaah" and "chandreshaaditijiivaahi". Directly corroborated by the page's own full 24-row "चतुर्विंशांशचक्र" table (even-sign column running in exact reverse of the odd-sign column, Bhima at row 1 through Skanda at row 24; zoom crops scratchpad/bphs-p79-table-rows1-3.png, bphs-p79-v24b-heading.png) and by the next page's (PDF p.80, printed page 48) full 27-row "भांशचक्रम्" table (column स्वामिनः, rows 1-11: Ashwini Kumara/Yama/Vahni/Brahma/Chandrama/Isha/Aditi/Jiva/Ahi/Pitarah/Bhaga), which confirms both the reading and the identification of "Dasra" with Ashwini Kumara. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अर्यमार्कत्वष्टमरुच्छक्राग्निमित्रवासवाः । निर्ऋत्युदकविश्वेऽजगोविन्दा वसवोऽम्बुपः ॥ २५ ॥

aryamaarkatvashtamaruchchhakraagnimitravaasavaah | nirritudakavishve'jagovindaa vasavo'mbupah || 25 ||

अंग्रेज़ी अर्थ

Aryama, Arka (Surya), Tvashta, Marut, Shakragni, Mitra, [and] Vasava; Nirriti, Udaka (Varuna as "water-lord"), Vishve(deva), [and] "Aja-Govinda" [DISCLOSED: the compressed compound "vishve'jagovindaa" is read as "vishve + ajagovindaah" -- i.e. "Aja" ("unborn") is taken as an epithet attached to "Govinda" rather than a separate twenty-fifth list-item, since the page's own 27-row Bhamsha-chakra table has no independent row between Vishvedeva and Govinda; this reading keeps the count of names in this verse's two lines (13 names across verses 24-25 so far) aligned with the table's rows 1-24], Vasu(s), [and] Ambupa ("water-drinker", i.e. Varuna again) -- [continuing, from verse 24's opening names, the twenty-seven lords of the Bhamsha (Saptavimshamsha, D-27), corresponding to the page's own table rows 12 (Aryama) through 24 (Varuna)].

हिन्दी अर्थ

अर्यमा, अर्क (सूर्य), त्वष्टा, मरुत्, शक्राग्नि, मित्र, तथा वासव; निर्ऋति, उदक (जल-स्वामी के रूप में वरुण), विश्वेदेव, तथा "अजगोविन्द" [स्पष्टीकरण: संक्षिप्त संयुक्त पद "विश्वेऽजगोविन्दा" को "विश्वे + अजगोविन्दाः" के रूप में पढ़ा गया है -- अर्थात् "अज" ("अजन्मा") को गोविन्द से जुड़ा विशेषण माना गया है, न कि एक अलग पच्चीसवाँ नाम, क्योंकि पृष्ठ की अपनी सत्ताईस-पंक्ति भांशचक्र तालिका में विश्वेदेव और गोविन्द के बीच कोई स्वतंत्र पंक्ति नहीं है; इससे श्लोक २४-२५ में अब तक के नामों की गिनती (तेरह) तालिका की पंक्ति १ से २४ तक से मेल खाती रहती है], वसु, तथा अम्बुप ("जलपायी", अर्थात् पुनः वरुण) -- [श्लोक २४ के आरम्भिक नामों से आगे बढ़ते हुए, भांश (सप्तविंशांश, D-27) के सत्ताईस अधिपों में से, पृष्ठ की अपनी तालिका की पंक्ति १२ (अर्यमा) से २४ (वरुण) तक के अनुरूप]।

स्रोत: BPHS Ch.6, verse 25, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.80 (printed page 48, chapter header "बृहत्पाराशरहोराशास्त्रम्"), read from a clean 600dpi full-page render and zoom crop (scratchpad/bphs-p80-v25-26.png) confirming the printed text letter-by-letter, including the sandhi-compressed compounds "aryamaarkatvashtamaruchchhakraagnimitravaasavaah" and "nirritudakavishve'jagovindaa vasavo'mbupah". Directly corroborated by the page's own full 27-row "भांशचक्रम्" table (column स्वामिनः, rows 12-24: Aryama/Surya/Tvashta/Marut/Shakragni/Mitra/Vasava/Rakshasa/Varuna/Vishvedeva/Govinda/Vasu/Varuna) and its prose commentary ("Mesh, Kark, Tulaa, Makar, in chaar char raashiyon se aarambhkar meshaadi raashiyon mein Saptavinshaadhip hote hain. Ashvinii aadi 27 nakshatron ke Dastra, Yam aadi svaamii hii unke dev hain"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ततोऽजपादहिर्बुध्न्यः पूषा चैव प्रकीर्तिताः । नक्षत्रेशास्तु भांशेशा अजादिचरराशितः ॥ २६ ॥

tato'japaadahirbudhnyah puushaa chaiva prakiirtitaah | nakshatreshaastu bhaansheshaa ajaadichararaashitah || 26 ||

अंग्रेज़ी अर्थ

Then (tatah) Ajapat, Ahirbudhnya, [and] (cha eva) Pusha are declared (prakiirtitaah) -- [completing the twenty-seven names, matching the page's own table's final three rows]. The lords of the [twenty-seven] Nakshatras (nakshatreshaah) are indeed (tu) the lords of the Bhamsha (bhaansheshaah, Saptavimshamsha), [reckoned] starting from Aja (Mesha) for a Chara (movable) [sign] [DISCLOSED: the verse states explicitly only the Mesha starting-point for movable signs; the page's own prose commentary supplies the remaining three (Karka, Tula, Makara, the other three movable signs), by which the same 27-name cycle repeats four times, once from each movable sign, across all twelve signs].

हिन्दी अर्थ

तत्पश्चात् अजपात्, अहिर्बुध्न्य, तथा पूषा कहे गए हैं -- [सत्ताईस नामों को पूर्ण करते हुए, पृष्ठ की अपनी तालिका की अन्तिम तीन पंक्तियों से मेल खाते हुए]। [सत्ताईस] नक्षत्रों के अधिप ही भांश (सप्तविंशांश) के अधिप हैं, चर राशि के लिए अज (मेष) से आरम्भ करके गिने जाते हैं [स्पष्टीकरण: श्लोक में स्पष्ट रूप से केवल मेष को ही चर राशियों का आरम्भ-बिन्दु कहा गया है; पृष्ठ की अपनी गद्य-टीका शेष तीन (कर्क, तुला, मकर, शेष तीन चर राशियाँ) देती है, जिनसे यही सत्ताईस-नाम चक्र बारह राशियों में चार बार, प्रत्येक चर राशि से एक बार, आवृत्त होता है]।

स्रोत: BPHS Ch.6, verse 26, Kashi Sanskrit Series No.220, PDF p.80 (printed page 48), read cleanly from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p80-v25-26.png), confirming the printed text letter-by-letter, including the sandhi "tato'japaat" (tatah + ajapaat) and the compound "ajaadichararaashitah". Directly corroborated by the page's own full 27-row "भांशचक्रम्" table (rows 25-27: Ajapat/Ahirbudhnya/Pusha), its prose commentary ("Mesh, Kark, Tulaa, Makar, in chaar char raashiyon se aarambhkar meshaadi raashiyon mein Saptavinshaadhip hote hain"), and a worked example (Lagna Tula, so counting from Tula itself, the 18th Bhamsha falls in Mina; hence Bhamshesha is Guru [Jupiter] with deity Vasava). Together, verses 24-26 give the complete 27-name Nakshatra/Bhamsha lord list, matching the page's own table row-for-row. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रिशांशेशाश्च विपमे कुजार्कीज्यज्ञभार्गवाः । पञ्चपञ्चाष्टसप्ताक्षभागा व्यत्ययतः समे ॥ २७ ॥

trishaanshesaashcha vipame kujaarkiijyajnabhaargavaah | panchapanchaashtasaptaakshabhaagaa vyatyayatah same || 27 ||

अंग्रेज़ी अर्थ

The lords of the Trishamsha (the Trimshamsha, D-30) [DISCLOSED: printed here as "त्रिशांश", lacking the compound's first anusvara -- this matches the same edition's already-noted spelling convention for the Vimshamsha in verses 17-19 ("विंशांश" printed as "विशांश"), which likewise drops the first anusvara while keeping the second], for an odd (vipame) [DISCLOSED: printed "विपमे" with प; the expected term is "विषमे" (vishame, "odd"), and this very page's verse 28 spells the cognate form "विषमेषु" correctly with ष -- so this is very likely a print/scan artifact substituting प for ष rather than a genuine alternate reading, though the printed letter is preserved here as transcribed] sign, are: Kuja (Mars), Arki (Shani/Saturn, "son of Arka"), Ijya (Guru/Jupiter, "the worshipped one"), Jna (Budha/Mercury, "the knowing one"), [and] Bhargava (Shukra/Venus, "descendant of Bhrigu") -- in that order. Their amsha-spans are five, five, eight, seven, [and] five (pancha-pancha-ashta-sapta-aksha [DISCLOSED: "aksha" ("eye"/"sense-organ") is used here as a numeral-word for "five", a standard Sanskrit convention of substituting a concrete noun of fixed count for its associated number]) degrees, by exchange (vyatyayatah) for an even (same) sign [i.e. the same five lords and the same five spans apply, but in reverse order].

हिन्दी अर्थ

त्रिशांश (त्रिंशांश, D-30) के अधिप [स्पष्टीकरण: यहाँ "त्रिशांश" मुद्रित है, जिसमें संयुक्त पद का पहला अनुस्वार नहीं है -- यह इसी संस्करण की विंशांश (श्लोक १७-१९, जहाँ "विंशांश" को "विशांश" मुद्रित किया गया था) में पहले से नोट की गई वर्तनी-परम्परा से मेल खाता है, जो पहला अनुस्वार छोड़कर दूसरा रखती है], विषम राशि [स्पष्टीकरण: यहाँ प सहित "विपमे" मुद्रित है; अपेक्षित शब्द "विषमे" (ष सहित) है, और इसी पृष्ठ के श्लोक २८ में सजातीय रूप "विषमेषु" सही ष सहित मुद्रित है -- अतः यह वास्तविक वैकल्पिक पाठ के बजाय प के स्थान पर ष का मुद्रण/स्कैन-दोष होने की अधिक सम्भावना है, फिर भी मुद्रित अक्षर को यथावत् रखा गया है] के लिए हैं: कुज (मंगल), अर्कि (शनि, "अर्क का पुत्र"), ईज्य (गुरु, "पूज्य"), ज्ञ (बुध, "ज्ञाता"), तथा भार्गव (शुक्र, "भृगु-वंशज") -- इसी क्रम में। इनके अंश-विभाग पाँच, पाँच, आठ, सात, तथा पाँच (पञ्चपञ्चाष्टसप्ताक्ष [स्पष्टीकरण: "अक्ष" ("नेत्र"/"इन्द्रिय") यहाँ पाँच की संख्या हेतु प्रयुक्त एक मानक संस्कृत परम्परा है, जिसमें निश्चित गणना वाली किसी वस्तु के नाम से उसकी संख्या सूचित की जाती है]) अंश के हैं, सम राशि में व्यत्यय (उलट) से -- अर्थात् वही पाँच अधिप तथा वही पाँच विभाग, किन्तु विपरीत क्रम में।

स्रोत: BPHS Ch.6, verse 27, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.81 (printed page 49, chapter header "षोडशवर्गवर्णनाध्यायः"). This page carries no watermark overlap on its verse text, so read cleanly from a standard 600dpi full-page render and zoom crops (scratchpad/bphs-p81-v27-line1-full.png, bphs-p81-v27-pancha.png, bphs-p81-visame-zoom.png confirming the प in "विपमे", bphs-p81-heading2.png confirming the "त्रिशांश" section heading's own anusvara placement). Directly corroborated by the page's Hindi prose commentary ("विषम राशियों में ५, ५, ८, ७, ५ अंशक्रम से मंगल, शनि, गुरु, बुध, शुक्र...त्रिंशांशेश होते हैं") and its full odd-sign "स्पष्टार्थ विषमत्रिंशांशचक्र" table (rows वह्निः/वायुः/शक्रः/धनदः/जलदः at amsha-boundaries ५,१०,१८,२५,३०, columns मेष/मिथुन/सिंह/तुला/धनु/कुंभ, lords मं./श./गु./बु./शु.). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वह्निः समीरशक्रौ च धनदो जलदस्तथा । विषमेषु क्रमाज्ज्ञेयाः समराशौ विपर्ययात् ॥ २८ ॥

vahnih samiirashakrau cha dhanado jaladastathaa | vishameshu kramaajjneyaah samaraashau viparyayaat || 28 ||

अंग्रेज़ी अर्थ

Vahni (Agni), Samira (Vayu) and (cha) Shakra (Indra), Dhanada (Kubera), and likewise (tathaa) Jalada (Varuna) -- these are to be known (jneyaah), in due order (kramaat), as the Trimshamsha's presiding deities for odd (vishameshu) signs; for an even (sama) sign, by reversal (viparyayaat) [i.e. in the opposite order: Jalada, Dhanada, Shakra, Samira, Vahni].

हिन्दी अर्थ

वह्नि (अग्नि), समीर (वायु) तथा (च) शक्र (इन्द्र), धनद (कुबेर), तथा इसी प्रकार (तथा) जलद (वरुण) -- ये विषम राशियों के लिए त्रिंशांश के अधिष्ठाता देवता क्रमशः जानने चाहिए; सम राशि में विपर्यय (उलटे क्रम) से -- अर्थात् विपरीत क्रम में जलद, धनद, शक्र, समीर, वह्नि।

स्रोत: BPHS Ch.6, verse 28, Kashi Sanskrit Series No.220, PDF p.81 (printed page 49), read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p81-v28-line1-full.png, bphs-p81-v28-line2-full.png), confirming the printed text letter-by-letter, including "विषमेषु" with its correctly-printed ष (which corroborates that verse 27's "विपमे" is a print artifact, not an alternate reading). Directly corroborated by the page's Hindi commentary ("विषम राशियों में अग्नि, वायु, इन्द्र, कुबेर, और वरुण, और समराशियों में विपरीत क्रम से...त्रिंशांशों के अधिदेव होते हैं") and its two full tables ("स्पष्टार्थ विषमत्रिंशांशचक्र" and "स्पष्टार्थ समत्रिंशांशचक्रम्", the latter's deity rows running in exact reverse of the former's), plus a worked example (Lagna Tula 11°29'38", an odd sign, so Trimshamshesha is Budh [Mercury] with Adhidevata Kubera). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चत्वारिंशद्विभागानामधिपा विषमे क्रियात् । विष्णुश्चन्द्रो मरीचिश्च त्वष्टा धाता शिवो रविः ॥ २९ ॥

chatvaarinshadvibhaagaanaamadhipaa vishame kriyaat | vishnushchandro mariichishcha tvashtaa dhaataa shivo ravih || 29 ||

अंग्रेज़ी अर्थ

The lords of the forty parts (chatvaarinshad-vibhaaganaam-adhipaah, i.e. of the Khavedamsha, D-40 [DISCLOSED: the printed compound shows the expected sandhi-voicing of "chatvaarinshat" (forty) before the voiced "vibhaaganaam" (of the parts), yielding "chatvaarinshad-"]) are to be reckoned (kriyaat), for an odd (vishame) sign [counting from Mesha, per the following verse's own commentary]: Vishnu, Chandra (the Moon), and (cha) Marichi, Tvashta, Dhata, Shiva, [and] Ravi (the Sun) -- the first seven names of a twelve-deity cycle that repeats across the Khavedamsha's forty divisions.

हिन्दी अर्थ

चालीस भागों के अधिप (खवेदांश, D-40 के अधिप [स्पष्टीकरण: मुद्रित संयुक्त पद में अपेक्षित सन्धि दिखती है, जिसमें स्वरयुक्त "विभागानाम्" से पहले "चत्वारिंशत्" का त् स्वरित होकर "चत्वारिंशद्-" बनता है]) विषम राशि के लिए इस प्रकार जानने चाहिए [मेष से गिनते हुए, अगले श्लोक की टीका के अनुसार]: विष्णु, चन्द्र, तथा मरीचि, त्वष्टा, धाता, शिव, तथा रवि -- ये बारह-देवता चक्र के, जो खवेदांश के चालीस भागों में आवृत्त होता है, पहले सात नाम हैं।

स्रोत: BPHS Ch.6, verse 29, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.82 (printed page 50, chapter header "बृहत्पाराशरहोराशास्त्रम्"). This page carries no watermark overlap on its verse text, so read cleanly from a standard 600dpi full-page render and zoom crops (scratchpad/bphs-p82-v29-line1b.png, bphs-p82-v29-word2.png confirming "विषमे" with its retroflex ष, bphs-p82-v29-line2b.png). Directly corroborated by the page's Hindi prose commentary ("विषम राशियों में मेष से, सम राशियों में तुला से आरम्भ कर खवेदांश (चत्वारिंशांश) के अधिपों का ज्ञान करना चाहिए। विष्णु, चन्द्र आदि क्रम से खवेदांशों के देव होते हैं") and its full "स्पष्टार्थ खवेदांशचक्र" table (rows 1-7: विष्णु/चन्द्र/मरीचि/त्वष्टा/धाता/शिवः/रविः, repeating every twelve rows across all forty). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यमो यक्षेशगन्धर्वौ कालो वरुण एव च । समभे तुलतो ज्ञेयाः स्वस्वाधिपसमन्विताः ॥ ३० ॥

yamo yaksheshagandharvau kaalo varuna eva cha | samabhe tulato jneyaah svasvaadhipasamanvitaah || 30 ||

अंग्रेज़ी अर्थ

Yama, Yakshesha (Kubera, "lord of the Yakshas") and (the dual "yaksheshagandharvau" pairing) Gandharva, Kala, and (eva cha) Varuna -- completing, together with verse 29's seven names, the Khavedamsha's twelve-deity cycle. For an even (samabhe) sign, [this same cycle of deities] is to be known (jneyaah) [DISCLOSED: rather than a reversed order as used for several preceding vargas (e.g. verses 24 and 28's "viloma"/"viparyaya"), this verse specifies a different starting point instead] starting from (tulatah) Tula (Libra) [rather than from Mesha], each accompanied by its own [sign-lord] (sva-sva-adhipa-samanvitaah) -- i.e. the Khavedamsha-lord of a given division is the planet ruling whichever zodiacal sign the deity-cycle's table places that division in.

हिन्दी अर्थ

यम, यक्षेश (कुबेर, "यक्षों का स्वामी") तथा (द्विवचन "यक्षेशगन्धर्वौ" युग्म से) गन्धर्व, काल, तथा (एव च) वरुण -- श्लोक २९ के सात नामों के साथ मिलकर, खवेदांश के बारह-देवता चक्र को पूर्ण करते हुए। सम राशि में, [यही बारह देवता चक्र] तुला से आरम्भ करके [स्पष्टीकरण: पूर्व कई वर्गों (जैसे श्लोक २४ का "विलोम" और श्लोक २८ का "विपर्यय") में प्रयुक्त उलटे क्रम के बजाय, यह श्लोक एक भिन्न आरम्भ-बिन्दु निर्दिष्ट करता है] जानने चाहिए, प्रत्येक अपने-अपने (राशि-स्वामी) से सहित -- अर्थात् किसी भाग का खवेदांशेश वही ग्रह है जो उस राशि का स्वामी है जिसमें देवता-चक्र की तालिका उस भाग को रखती है।

स्रोत: BPHS Ch.6, verse 30, Kashi Sanskrit Series No.220, PDF p.82 (printed page 50), read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p82-v30-line1.png, bphs-p82-v30-word.png confirming "तुलतो", not a reversal-word, against the page's own commentary). Directly corroborated by the Hindi commentary ("विषम राशियों में मेष से, सम राशियों में तुला से आरम्भ कर खवेदांश...के अधिपों का ज्ञान करना चाहिए"), the full "स्पष्टार्थ खवेदांशचक्र" table (rows 8-12: यमः/यक्षेशः/गान्धर्वः/कालः/वरुणः, and the cycle's repetition every twelve rows across forty), and a worked example (Lagna Tula 11 deg 29'13.8", an odd sign, so counting from Mesha the 26th part falls in Vrishabha; hence Khavedamshesha is Shukra [Venus, lord of Vrishabha] with deity Chandra [row 26 mod 12 = row 2 of the cycle]). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तथाऽक्षवेदभागानामधिपाश्चरभे क्रियात् । स्थिरे सिंहाद् द्विस्वभावे चापाद् ब्रह्मेशकेशवाः ॥ ३१ ॥

tathaa'kshavedabhaagaanaamadhipaashcharabhe kriyaat | sthire sinhaad dvisvabhaave chaapaad brahmeshakeshavaah || 31 ||

अंग्रेज़ी अर्थ

Thus (tathaa) the lords of the Akshaveda(msha) parts (akshaveda-bhaaganaam-adhipaah, i.e. of the Akshavedamsha, D-45) are to be reckoned (kriyaat) for a movable (chara) sign [DISCLOSED: this half-line names only "charabhe kriyaat" ("for a movable sign, let it be done") without stating the starting sign explicitly here; the page's own Hindi commentary supplies it as Mesha (Aries)]; from Simha (sinhaad, Leo), for a fixed (sthira) sign; from Chapa (chaapaad, Dhanu/Sagittarius), for a dual-bodied (dvisvabhaava) sign -- [and the three deities cycling through these forty-five divisions are named as] Brahma, Isha (Shiva), [and] Keshava (Vishnu).

हिन्दी अर्थ

इस प्रकार (तथा) अक्षवेद(अंश) के भागों (अक्षवेदभागानाम्) के अधिप, चर राशि के लिए, इस प्रकार (क्रियात्) जानने चाहिए [स्पष्टीकरण: इस अर्ध-श्लोक में केवल "चरभे क्रियात्" ("चर राशि के लिए, ऐसा करें") कहा गया है, आरम्भ-राशि का स्पष्ट नाम नहीं दिया गया है; पृष्ठ की अपनी हिन्दी टीका इसे मेष बताती है]; स्थिर राशि के लिए सिंह से; द्विस्वभाव राशि के लिए धनु (चाप) से -- तथा इन पैंतालीस भागों में आवृत्त होने वाले तीन देवता ब्रह्मा, ईश (शिव), तथा केशव (विष्णु) कहे गए हैं।

स्रोत: BPHS Ch.6, verse 31 (opening the "अक्षवेदांश" [Akshavedamsha, D-45] subsection), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.83 (printed page 51, chapter header "षोडशवर्गवर्णनाध्यायः"), following the tail rows (24-40) of the preceding page's Khavedamsha chakra table, which carries over onto this page's top before the Akshavedamsha heading. This page carries no watermark overlap on its verse text, so read cleanly from a standard 600dpi full-page render and zoom crop (scratchpad/bphs-p83-v31-32.png). Directly corroborated by the page's own Hindi prose commentary ("चरराशियों में मेष से स्थिर राशियों में सिंह से और द्विस्वभाव राशियों में धनु से आरम्भ कर अक्षवेदांशेश का ज्ञान होता है। चरराशियों में ब्रह्मा, शिव, विष्णु स्थिरराशियों में शिव, विष्णु, ब्रह्मा, एवं द्विस्वभाव राशियों में विष्णु, ब्रह्मा, शिव, पन्द्रह आवृत्तिक्रम से अधिदेव होते हैं") and a worked example (Lagna Tula 6°19'29"38, a movable sign, so counting from Mesha the 30th Akshavedamsha falls in Kanya; Akshavedamshesha Budh with deity Keshava). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ईशाच्युतसुरज्येष्ठा विष्णुकेशाश्वरादिषु । देवता विबुधैरुक्ता वाणचन्द्राद्वृतिक्रमात् ॥ ३२ ॥

iishaachyutasurajyeshthaa vishnukeshaashvaraadishu | devataa vibudhairuktaa vaanachandraadvritikramaat || 32 ||

अंग्रेज़ी अर्थ

Isha (Shiva), Achyuta (Vishnu), [and] Surajyeshtha ("eldest among the gods", Brahma) [DISCLOSED: these three names restate, by synonym, the same triad already given at the end of verse 31 (Brahma, Isha, Keshava)] -- in [the cycle] beginning with (aadishu) Vishnu, Kesha, [and a third name printed as] "Ashvara" [DISCLOSED: this portion of the compound "vishnukeshaashvaraadishu" was not confidently legible even at high zoom; it most likely represents an intended "Ishvara" (Shiva), but the printed vowel sequence reads "अश्वर" rather than the expected "ईश्वर" -- possibly another instance of this edition's recurring vowel-substitution artifacts, disclosed rather than silently corrected] -- these deities are declared (uktaa) by the wise (vibudhaih), by a repetition-cycle (vrittikramaat [DISCLOSED: printed with a single त, "वृतिक्रमात्", rather than the expected geminate "वृत्तिक्रमात्" -- consistent with this edition's established pattern (cf. verse 27's dropped anusvara) of dropping a doubled or nasalized letter in certain compounds]) of fifteen (vaanachandraat [DISCLOSED: read via bhuta-samkhya numeral-words -- "vaana" ("arrow", from Kama's five flower-arrows) standing for 5 as the units digit, and "chandra" ("the [single] moon") standing for 1 as the tens digit, giving 15 -- confirmed directly by the page's own Hindi commentary, which states these three deities repeat in a "पन्द्रह आवृत्तिक्रम" (fifteen-fold repetition-cycle) across the Akshavedamsha's forty-five divisions]).

हिन्दी अर्थ

ईश (शिव), अच्युत (विष्णु), तथा सुरज्येष्ठ ("देवताओं में ज्येष्ठ", ब्रह्मा) [स्पष्टीकरण: ये तीन नाम श्लोक ३१ के अन्त में दी गई उसी त्रिमूर्ति (ब्रह्मा, ईश, केशव) को पर्यायवाची नामों से पुनः कहते हैं] -- विष्णु, केश, तथा एक तीसरे नाम, जो "अश्वर" मुद्रित है [स्पष्टीकरण: संयुक्त पद "विष्णुकेशाश्वरादिषु" का यह भाग उच्च ज़ूम पर भी पूर्ण विश्वास से नहीं पढ़ा जा सका; यह सम्भवतः "ईश्वर" (शिव) होने का अभिप्राय रखता है, परन्तु मुद्रित स्वर-क्रम अपेक्षित "ईश्वर" के स्थान पर "अश्वर" पढ़ा जाता है -- सम्भवतः इसी संस्करण के आवर्ती स्वर-प्रतिस्थापन दोषों का एक और उदाहरण, जिसे चुपचाप सुधारने के बजाय यहाँ स्पष्ट किया गया है] -- से आरम्भ होने वाले [चक्र] में, ये देवता विद्वानों द्वारा कहे गए हैं (उक्ता), एक आवृत्ति-क्रम से (वृत्तिक्रमात् [स्पष्टीकरण: यहाँ एकल त् सहित "वृतिक्रमात्" मुद्रित है, अपेक्षित द्वित्व त् सहित "वृत्तिक्रमात्" के स्थान पर -- यह इसी संस्करण की पहले से ज्ञात परम्परा (श्लोक २७ के लुप्त अनुस्वार की भाँति) से मेल खाता है, जिसमें कुछ संयुक्त पदों में द्वित्व या अनुनासिक अक्षर छूट जाता है]) पन्द्रह के (वाणचन्द्रात् [स्पष्टीकरण: भूतसंख्या शब्दों से पढ़ा गया -- "वाण" ("बाण", कामदेव के पाँच पुष्प-बाणों से) इकाई अंक ५ के लिए, तथा "चन्द्र" ("[एकमात्र] चन्द्रमा") दहाई अंक १ के लिए, इस प्रकार १५ बनता है -- इसकी पुष्टि पृष्ठ की अपनी हिन्दी टीका से सीधे होती है, जो कहती है कि ये तीन देवता अक्षवेदांश के पैंतालीस भागों में "पन्द्रह आवृत्तिक्रम" से आवृत्त होते हैं])।

स्रोत: BPHS Ch.6, verse 32, Kashi Sanskrit Series No.220, PDF p.83 (printed page 51), read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p83-v32-line2.png, bphs-p83-v32-word-zoom.png and bphs-p83-v32-vrtti-zoom.png confirming the single-त "वृतिक्रमात्", bphs-p83-v32-vishnukesha-zoom.png showing the not-fully-resolved "अश्वर" portion). Directly corroborated by the page's own Hindi prose commentary ("चरराशियों में ब्रह्मा, शिव, विष्णु...पन्द्रह आवृत्तिक्रम से अधिदेव होते हैं") and the same worked example carried over from verse 31 (Lagna Tula 6°19'29"38, a movable sign; 30th Akshavedamsha in Kanya, Akshavedamshesha Budh, deity Keshava). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राशीन् विहाय खेटस्य द्विघ्नमंशाद्यमर्कहृत् । शेषं सैकं च तद्राशिनाथाः षष्ट्यंशपाः स्मृताः ॥ ३३ ॥

raashiin vihaaya khetasya dvighnamanshaadyamarkahrut | sheshan saikan cha tadraashinaathaah shashtyanshapaah smrutaah || 33 ||

अंग्रेज़ी अर्थ

Leaving aside (vihaaya) the [whole] signs (raashiin) of the planet (khetasya), [take] the doubled (dvighnam) amsha-figure (amshaadyam, i.e. the degrees-within-sign and finer parts), divided by (hrut) arka [DISCLOSED: "arka" (lit. "the sun") is used here as a bhuta-samkhya numeral-word for twelve, corresponding to the twelve Adityas/Arkas of tradition]; the remainder plus one (sheshan sa-ekam), and (cha) the lord of that [resultant, counted-forward] sign (tad-raashi-naathaah) -- [these] are traditionally said (smrutaah) to be the lords of the Shashtyamsha (shashtyansha-paah, D-60).

हिन्दी अर्थ

ग्रह (खेटस्य) की राशियों को छोड़कर (राशीन् विहाय), अंशादि (राशि-भीतर के अंश-कला आदि) को दुगुना करके (द्विघ्नम्), अर्क से (अर्कहृत् [स्पष्टीकरण: "अर्क" (शाब्दिक अर्थ "सूर्य") यहाँ बारह की संख्या के लिए भूतसंख्या शब्द के रूप में प्रयुक्त है, परम्परा के बारह आदित्यों/अर्कों के अनुरूप]) भाग देने पर, शेष में एक जोड़कर (शेषं सैकं च), उस [गिनी गई] राशि का जो स्वामी है (तद्राशिनाथाः), वही षष्ट्यंश (D-60) का अधिप परम्परा से कहा गया है (स्मृताः)।

स्रोत: BPHS Ch.6, verse 33 (opening the "षष्ट्यंश" [Shashtyamsha, D-60] subsection), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.85 (printed page 53, chapter header "षोडशवर्गवर्णनाध्यायः"). This page carries no watermark overlap on its verse text, so read cleanly from a standard 600dpi full-page render and zoom crop (scratchpad/bphs-p85-v33.png). Directly corroborated by the page's own Hindi prose commentary and worked example (Lagna Tula 6°19'29"38: amsha-adi doubled = 38'59"16, divided by 12 leaves remainder 2, plus 1 = 3; hence counting three signs from Tula gives Dhanu, whose lord Guru is the Shashtyamshesha). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षष्ट्यंशाधिदेव— घोरश्च राक्षसो देवः कुबेरो यक्षकिन्नरौ । भ्रष्टः कुलघ्नो गरलो वह्निर्माया परीषकः ॥ ३४ ॥

shashtyanshaadhideva-- ghorashcha raakshaso devah kubero yakshakinnarau | bhrashtah kulaghno garalo vahnirmaayaa pariishakah || 34 ||

अंग्रेज़ी अर्थ

[Sub-heading:] The presiding deities of the Shashtyamsha. Ghora, and (cha) Rakshasa, Deva, Kubera, [and the dual] Yaksha [and] Kinnara; Bhrashta, Kulaghna, Garala, Vahni, Maya, [and] Parishaka [DISCLOSED: printed clearly as "भ्रष्टः", not the visually similar "अष्टः", confirmed at high zoom] -- the first twelve names opening the sixty-deity cycle of the Shashtyamsha.

हिन्दी अर्थ

[उपशीर्षक:] षष्ट्यंश के अधिष्ठाता देवता। घोर, तथा (च) राक्षस, देव, कुबेर, तथा (द्विवचन) यक्ष एवं किन्नर; भ्रष्ट [स्पष्टीकरण: उच्च ज़ूम पर स्पष्ट रूप से "भ्रष्टः" मुद्रित पाया गया, दिखने में मिलते-जुलते "अष्टः" के स्थान पर नहीं], कुलघ्न, गरल, वह्नि, माया, तथा परीषक -- षष्ट्यंश के साठ-देवता चक्र के आरम्भिक बारह नाम।

स्रोत: BPHS Ch.6, verse 34, Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v34-35b.png, bphs-p85-v34-line2-zoom.png confirming "भ्रष्टः", bphs-p85-v34-line2b-zoom.png confirming "परीषकः"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अपांपतिर्मरुत्वांश्च कालः सर्पामृतेन्दुकाः । मृदुः कोमल-हेरम्ब-ब्रह्मविष्णुमहेश्वराः ॥ ३५ ॥

apaampatirmarutvaanshcha kaalah sarpaamrutendukaah | mruduh komala-heramba-brahmavishnumaheshvaraah || 35 ||

अंग्रेज़ी अर्थ

Apampati (Varuna, "lord of the waters"), and (cha) Marutvan (Indra), Kala, Sarpa, Amrita, [and] Induka (the moon); Mridu, Komala, Heramba (Ganesha), Brahma, Vishnu, [and] Maheshvara (Shiva) -- continuing the deity-cycle with twelve further names.

हिन्दी अर्थ

अपांपति (वरुण, "जलों का स्वामी"), तथा (च) मरुत्वान् (इन्द्र), काल, सर्प, अमृत, तथा इन्दुक (चन्द्रमा); मृदु, कोमल, हेरम्ब (गणेश), ब्रह्मा, विष्णु, तथा महेश्वर (शिव) -- देवता-चक्र को आगे बारह और नामों से बढ़ाते हुए।

स्रोत: BPHS Ch.6, verse 35, Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v35.png, bphs-p85-v35-line2.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

देवाद्रौ कलिनाशश्च क्षितीशकमलाकरौ । गुलिको मृत्युकालश्च दावाग्निर्घोरसंज्ञकः ॥ ३६ ॥

devaadrau kalinaashashcha kshitiishakamalaakarau | guliko mrutyukaalashcha daavaagnirghorasanjnakah || 36 ||

अंग्रेज़ी अर्थ

[The dual] Deva [and] Adri ("Deva-Adri") [DISCLOSED: confirmed at high zoom to read literally "देवाद्रौ", with a short अ, i.e. "Deva" + "Adri" (mountain) in dual case -- not "आर्द्रौ" (a possible reading suggesting the Ardra nakshatra-deity, Rudra); the segmentation as "Deva-Adri" is offered only as the plain grammatical reading of what is printed, not as a match against any externally-recalled canonical name list], and (cha) Kalinasha, [and the dual] Kshitisha [and] Kamalakara; Gulika, and (cha) Mrityukala, [and] Davagni, called (sanjnakah) Ghora -- continuing the deity-cycle further.

हिन्दी अर्थ

[द्विवचन] देव तथा अद्रि ("देवाद्रि") [स्पष्टीकरण: उच्च ज़ूम पर स्पष्ट रूप से ह्रस्व अ सहित "देवाद्रौ" पढ़ा गया, अर्थात् द्विवचन में "देव" + "अद्रि" (पर्वत) -- न कि "आर्द्रौ" (एक सम्भावित पाठ जो आर्द्रा नक्षत्र के देवता रुद्र की ओर संकेत कर सकता है); "देव-अद्रि" के रूप में विभाजन केवल मुद्रित पाठ की सीधी व्याकरणिक पठन-प्रस्तुति है, किसी बाहरी रूप से स्मरण की गई मानक नाम-सूची से मिलान के रूप में नहीं], तथा (च) कलिनाश, तथा [द्विवचन] क्षितीश एवं कमलाकर; गुलिक, तथा (च) मृत्युकाल, तथा दावाग्नि, जो घोर संज्ञक (घोर नाम से प्रसिद्ध) है -- देवता-चक्र को आगे बढ़ाते हुए।

स्रोत: BPHS Ch.6, verse 36, Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v36-line1-left.png, bphs-p85-v36-devadrau-zoom3.png confirming the short-अ "देवाद्रौ" at 3x magnification, bphs-p85-v36-line2.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यमश्च कण्टकसुधाऽमृतपूर्णनिशाकराः । विषदग्धः कुलान्तश्च शुभ्यो वंशक्षयस्तथा ॥ ३७ ॥

yamashcha kantakasudhaamrutapuurnanishaakaraah | vishadagdhah kulaantashcha shubhyo vanshakshayastathaa || 37 ||

अंग्रेज़ी अर्थ

Yama, and (cha) Kantaka, Sudha, Amrita, [and] Purnanishakara ("the full moon"); Vishadagdha, Kulanta, and (cha) [a name printed as] "Shubhya" [DISCLOSED: printed clearly as "शुभ्यो"; grammatically a form such as "शुभ्रः" (Shubhra, "the bright one") might be expected in this position, but the printed reading "शुभ्यो" is preserved as transcribed rather than silently emended], and likewise (tathaa) Vanshakshaya -- continuing the deity-cycle further.

हिन्दी अर्थ

यम, तथा (च) कण्टक, सुधा, अमृत, तथा पूर्णनिशाकर ("पूर्ण चन्द्रमा"); विषदग्ध, कुलान्त, तथा (च) एक नाम जो "शुभ्यो" मुद्रित है [स्पष्टीकरण: स्पष्ट रूप से "शुभ्यो" मुद्रित है; इस स्थान पर व्याकरणदृष्ट्या "शुभ्रः" (शुभ्र, "उज्ज्वल") जैसा रूप अपेक्षित हो सकता है, परन्तु मुद्रित पाठ "शुभ्यो" को बिना मौन सुधार के यथावत् रखा गया है], तथा इसी प्रकार (तथा) वंशक्षय -- देवता-चक्र को आगे बढ़ाते हुए।

स्रोत: BPHS Ch.6, verse 37, Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v37.png, bphs-p85-v37-shubhyo-zoom.png confirming "शुभ्यो" at 3x magnification). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

उत्पातकालसौम्याख्याः कोमलः शीतलाभिधः । करालदंष्ट्रचन्दाख्यौ प्रवीणः कालपावकः ॥ ३८ ॥

utpaatakaalasaumyaakhyaah komalah shiitalaabhidhah | karaaladanshtrachandaakhyau praviinah kaalapaavakah || 38 ||

अंग्रेज़ी अर्थ

[Deities] named (aakhyaah) Utpatakala [and] Saumya; Komala, [one] called (abhidhah) Shitala; [the dual] named Karaladamshtra [and] Chanda; Pravina, [and] Kalapavaka -- continuing the deity-cycle further.

हिन्दी अर्थ

उत्पातकाल तथा सौम्य नाम वाले [देवता]; कोमल, शीतल नाम वाला; करालदंष्ट्र तथा चण्ड नाम वाला [द्विवचन]; प्रवीण, तथा कालपावक -- देवता-चक्र को आगे बढ़ाते हुए।

स्रोत: BPHS Ch.6, verse 38, Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v38.png, bphs-p85-v38-num-zoom2.png confirming the printed verse-number "३८" at 3x magnification). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दण्डभृन्निर्मलः सौम्यः क्रूरोऽतिशीतलोऽमृतः । पयोधिभ्रमणाख्यौ च चन्द्ररेखा त्वयुग्मपाः ॥ २९ ॥

dandabhrunnirmalah saumyah kruuro'tishiitalo'mrutah | payodhibhramanaakhyau cha chandrarekhaa tvayugmapaah || 29 ||

अंग्रेज़ी अर्थ

Dandabhrit, Nirmala, Saumya, Krura, Atishitala, [and] Amrita; [the dual] named Payodhi [and] Bhramana, and (cha) Chandrarekha -- these are the odd-sign (ayugma) lords [of the corresponding Shashtyamsha divisions] [DISCLOSED: printed verse-ending number reads "२९" (29), not the sequentially expected "३९" (39). This was confirmed genuinely legible, not a low-resolution artifact, via two rounds of 3x zoom cropping (scratchpad/bphs-p85-v39-num-zoom2.png), while the immediately preceding verse 38 (confirmed "३८") and following verse 40 (confirmed "४०") both carry their correct sequential numbers -- meaning the source page itself misprints this one verse's number, most likely a single-stroke ३/२ font confusion. The verse is ref'd "6.39" here for sequential consistency with this file's chapter-verse numbering, while this note preserves the source page's actual printed digits.]

हिन्दी अर्थ

दण्डभृत्, निर्मल, सौम्य, क्रूर, अतिशीतल, तथा अमृत; [द्विवचन] पयोधि तथा भ्रमण नाम वाला, तथा (च) चन्द्ररेखा -- ये अयुग्म (विषम) राशि के [सम्बन्धित षष्ट्यंश भागों के] अधिप हैं [स्पष्टीकरण: मुद्रित श्लोकान्त संख्या "२९" (29) पढ़ी गई, न कि क्रमानुसार अपेक्षित "३९" (39)। यह वास्तव में स्पष्ट रूप से मुद्रित पाया गया, न कि निम्न-रिज़ॉल्यूशन का दोष, दो बार 3x ज़ूम क्रॉप (scratchpad/bphs-p85-v39-num-zoom2.png) से पुष्टि के बाद, जबकि ठीक पहले वाला श्लोक ३८ (पुष्टि "३८") तथा ठीक बाद वाला श्लोक ४० (पुष्टि "४०") दोनों अपनी सही क्रमिक संख्याएँ रखते हैं -- अर्थात् स्रोत पृष्ठ में स्वयं इस एक श्लोक की संख्या का मुद्रण-दोष है, सम्भवतः ३ और २ की एकल-रेखा समानता से उत्पन्न। यहाँ इस श्लोक को इस फ़ाइल की क्रमिक अध्याय-श्लोक संख्या के अनुरूप "6.39" के रूप में सन्दर्भित किया गया है, जबकि यह टिप्पणी स्रोत पृष्ठ की वास्तविक मुद्रित संख्या को सुरक्षित रखती है।]

स्रोत: BPHS Ch.6, verse printed as "२९" (positionally the ninth deity-list verse of this Shashtyamsha subsection, following verse 38 and preceding verse 40; ref'd "6.39" here for sequential file consistency -- see disclosure in translation/translationHi), Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v39.png, bphs-p85-v39-line2.png, bphs-p85-v39-num-zoom2.png confirming the printed "२९" at 3x magnification; cross-checked against bphs-p85-v38-num-zoom2.png confirming verse 38's correct "३८" and bphs-p85-v40-line2.png confirming verse 40's correct "४०", ruling out a genuine intentional renumbering). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

समे भे व्यत्ययाज्ज्ञेयाः षष्ट्यंशेशाः सदा बुधैः । षष्ट्यंशस्वामिनस्त्वोजे तदीशाद् व्यत्ययात् समे ॥ ४० ॥

same bhe vyatyayaajjneyaah shashtyanshesaah sadaa budhaih | shashtyanshasvaaminastvoje tadiishaad vyatyayaat same || 40 ||

अंग्रेज़ी अर्थ

For an even (same) sign (bhe), the lords of the Shashtyamsha (shashtyansha-ishaah) are ever (sadaa) to be known (jneyaah) by reversal (vyatyayaat) by the wise (budhaih); [i.e.] the lords of the Shashtyamsha, for an odd (oje) [sign, run in due order] from that [sign's own] lord (tad-iishaat) [DISCLOSED: "tadiishaat" ("from its own lord") is read here as shorthand cross-referring to the deity-cycle order already given in verses 34-39 for the odd-sign case], by reversal (vyatyayaat) for an even (same) [sign, i.e. the same cycle run in the opposite order].

हिन्दी अर्थ

सम राशि (भे) में, षष्ट्यंश के अधिप सदा विद्वानों द्वारा व्यत्यय (उलटे क्रम) से जानने चाहिए; [अर्थात्] षष्ट्यंश के स्वामी, विषम (ओजे) राशि के लिए उसी [राशि के अपने] स्वामी से [क्रमशः चलते हैं] [स्पष्टीकरण: "तदीशात्" ("उसी के स्वामी से") को यहाँ श्लोक ३४-३९ में विषम राशि हेतु पहले से दिए गए देवता-चक्र क्रम के संक्षिप्त सन्दर्भ के रूप में पढ़ा गया है], सम राशि में व्यत्यय (उलट) से।

स्रोत: BPHS Ch.6, verse 40, Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v40.png, bphs-p85-v40-line2.png confirming the printed verse-number "४०", which -- together with verse 38's confirmed "३८" -- corroborates that the intervening verse's "२९" (ref'd 6.39 here) is a genuine printed numbering anomaly rather than a misreading on this end). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुभषष्ट्यंशसंयुक्ता ग्रहाः शुभफलप्रदाः । क्रूरषष्ट्यंशसंयुक्ता नाशयन्ति खचारिणः ॥ ४१ ॥

shubhashashtyanshasanyuktaa grahaah shubhaphalapradaah | kruuroshashtyanshasanyuktaa naashayanti khachaarinah || 41 ||

अंग्रेज़ी अर्थ

Planets (grahaah) joined with (sanyuktaa) a benefic (shubha) Shashtyamsha are givers of benefic results (shubha-phala-pradaah); [those] joined with a malefic/cruel (kruura) Shashtyamsha, the sky-movers (khachaarinah, i.e. the planets), destroy [their good results] (naashayanti) -- closing this chapter's treatment of the Shashtyamsha (D-60).

हिन्दी अर्थ

शुभ षष्ट्यंश से युक्त ग्रह शुभ फल देने वाले होते हैं; क्रूर षष्ट्यंश से युक्त आकाशचारी (अर्थात् ग्रह) [अपने शुभ फलों को] नष्ट कर देते हैं -- इसी के साथ इस अध्याय में षष्ट्यंश (D-60) का वर्णन पूर्ण होता है।

स्रोत: BPHS Ch.6, verse 41 (closing the Shashtyamsha subsection), Kashi Sanskrit Series No.220, PDF p.85 (printed page 53), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p85-v41-zoom.png confirming "शुभषष्ट्यंशसंयुक्ता" at 2x magnification, bphs-p85-v41-line2-zoom.png confirming "क्रूरषष्ट्यंशसंयुक्ता ... ॥ ४१ ॥"). Directly corroborated by the page's own Hindi prose commentary ("शुभषष्ठ्यंश युक्त ग्रह शुभफल देनेवाले होते हैं और क्रूर ग्रह के षष्ठ्यंशसंयुक्त ग्रह नाश...") immediately following, and by the full 60-row "स्पष्टार्थ षष्ट्यंशचक्रम्" table on the next printed page (54; scratchpad/bphs-p86-tiny.png), which is pure numeric/name corroborating content, not verse text, and closes this chapter's varga-definition sequence. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वर्गभेद— वर्गभेदानहं वक्ष्ये मैत्रेय ! त्वं विधारय । षड्वर्गाः सप्तवर्गाश्च दिग्वर्गा नृपवर्गकाः ॥ ४२ ॥

vargabheda-- vargabhedaanaham vakshye maitreya ! tvam vidhaaraya | shadvargaah saptavargaashcha digvargaa nrupavargakaah || 42 ||

अंग्रेज़ी अर्थ

[Sub-heading:] Vargabheda ("the distinctions/classification of vargas"). I shall now tell (aham vakshye) the varga-distinctions (varga-bhedaan), O Maitreya! You hold this in mind (tvam vidhaaraya). [There are] the Shad-vargas (six-fold groupings), and (cha) the Sapta-vargas (seven-fold groupings), the Dig-vargas, [and] the Nripa-vargas [UPDATED, confirmed by the following page: a subsequent page (PDF p.88, printed page 56) supplies this same edition's own Hindi commentary, which walks through these same four groupings by count rather than by the verse's own names -- "षड्वर्ग" (six), "सप्तवर्ग" (seven, sharing the Shad-varga's names but adding an eighth-numbered name at 7), "दशवर्ग" (ten), and "षोडश वर्ग" (sixteen). This confirms "Dig-vargaah" denotes the ten-fold scheme -- via the same bhuta-samkhya convention already seen at verse 47, where "dik" ("direction") stands for the numeral ten, there being traditionally ten directions -- and that "Nripa-vargakaah" ("royal/sovereign groupings") is this edition's own poetic name (confirmed printed clearly, not a misreading) for what the commentary elsewhere calls by its plain count, the sixteen-fold (Shodasha-varga) scheme -- fitting, since this whole chapter is itself titled "षोडशवर्गवर्णनाध्यायः" ("the chapter describing the sixteen vargas")].

हिन्दी अर्थ

[उपशीर्षक:] वर्गभेद ("वर्गों का वर्गीकरण/भेद")। हे मैत्रेय! अब मैं वर्ग-भेदों को कहूँगा (वक्ष्ये); तुम इसे धारण करो (विधारय)। षड्वर्ग (छह वर्गों के समूह), तथा (च) सप्तवर्ग (सात वर्गों के समूह), दिग्वर्ग, तथा नृपवर्ग [के समूह होते हैं] [अद्यतन, अगले पृष्ठ से पुष्ट: अगले पृष्ठ (पीडीएफ पृ.८८, मुद्रित पृष्ठ ५६) पर इसी संस्करण की अपनी हिन्दी टीका इन्हीं चार समूहों को श्लोक के नामों के बजाय उनकी संख्या से समझाती है -- "षड्वर्ग" (छह), "सप्तवर्ग" (सात, षड्वर्ग के ही नामों को साझा करते हुए सात पर एक आठवाँ नाम जोड़ते हुए), "दशवर्ग" (दस), तथा "षोडश वर्ग" (सोलह)। इससे पुष्टि होती है कि "दिग्वर्गाः" दस-अंकीय योजना को दर्शाता है -- श्लोक ४७ में पहले से देखी गई उसी भूतसंख्या परम्परा से, जिसमें "दिक्" ("दिशा") संख्या दस के लिए प्रयुक्त है, क्योंकि परम्परा में दस दिशाएँ मानी जाती हैं -- तथा यह भी कि "नृपवर्गकाः" ("राजयोग्य/प्रभुत्व-सम्बन्धी समूह") इसी संस्करण का अपना काव्यात्मक नाम है (स्पष्ट रूप से मुद्रित पाया गया, गलत पठन नहीं) उस सोलह-अंकीय (षोडशवर्ग) योजना के लिए, जिसे टीका अन्यत्र केवल उसकी संख्या से कहती है -- यह उपयुक्त भी है, क्योंकि यह सम्पूर्ण अध्याय स्वयं "षोडशवर्गवर्णनाध्यायः" ("सोलह वर्गों का वर्णन करने वाला अध्याय") नाम से शीर्षित है]।

स्रोत: BPHS Ch.6, verse 42 (opening a new subsection, "वर्गभेद", following immediately after the Shashtyamsha section and its 60-row table), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.87 (printed page 55, chapter header "षोडशवर्गवर्णनाध्यायः"), with the naming of its "दिग्वर्गाः" and "नृपवर्गकाः" groupings cross-checked and confirmed via the following page's (PDF p.88, printed page 56) own Hindi commentary table. Read cleanly from a standard 600dpi full-page render and zoom crops (scratchpad/bphs-p87-v42.png, scratchpad/bphs-p87-v42-word4-zoom.png at 3x magnification confirming "नृपवर्गकाः" is printed exactly as such). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भवन्ति वर्गसंयोगे षड्वर्गे किंशुकाद्यः । द्वाभ्यां किंशुकनामा च त्रिभिर्व्यञ्जनमुच्यते ॥ ४३ ॥

bhavanti vargasanyoge shadvarge kinshukaadyah | dvaabhyaan kinshukanaamaa cha tribhirvyanjanamuchyate || 43 ||

अंग्रेज़ी अर्थ

In the combination of vargas (varga-sanyoge), in the Shad-varga [group] (shad-varge), [yogas] beginning with (aadyah) Kimshuka arise (bhavanti). By two [vargas agreeing] (dvaabhyaam), it is named (naamaa) Kimshuka; and (cha) by three (tribhih), it is called (uchyate) Vyanjana.

हिन्दी अर्थ

वर्गों के संयोग में (वर्गसंयोगे), षड्वर्ग [समूह] में, किंशुक आदि [योग] उत्पन्न होते हैं (भवन्ति)। दो [वर्गों के मेल] से (द्वाभ्यां), इसे किंशुक नाम दिया जाता है; तथा (च) तीन से (त्रिभिः), इसे व्यञ्जन कहा जाता है (उच्यते)।

स्रोत: BPHS Ch.6, verse 43, Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read cleanly from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p87-v43.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुर्भिश्चामराख्यं च छत्रं पञ्चभिरेव च । षड्भिः कुण्डलयोगः स्यान्मुकुटाख्यं च सप्तभिः ॥ ४४ ॥

chaturbhishchaamaraakhyam cha chhatram panchabhireva cha | shadbhih kundalayogah syaanmukutaakhyam cha saptabhih || 44 ||

अंग्रेज़ी अर्थ

By four (chaturbhih), and (cha) it is [also] named (aakhyam) Amara; and (cha) by five (panchabhih), Chhatra ("umbrella"); by six (shadbhih), it is (syaat) the Kundala-yoga; and (cha) by seven (saptabhih), it is named Mukuta ("crown").

हिन्दी अर्थ

चार [वर्गों के मेल] से (चतुर्भिः), इसे अमर नाम भी दिया जाता है; तथा (च) पाँच से (पञ्चभिः), छत्र; छह से (षड्भिः), यह कुण्डलयोग होता है; तथा (च) सात से (सप्तभिः), इसे मुकुट नाम दिया जाता है।

स्रोत: BPHS Ch.6, verse 44, Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read cleanly from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p87-v44.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सप्तवर्गेऽथ दिग्वर्गे पारिजातादिसंज्ञकाः । पारिजातं भवेद् द्वाभ्यामुत्तमं त्रिभिरुच्यते ॥ ४५ ॥

saptavarge'tha digvarge paarijaataadisanjnakaah | paarijaatan bhaved dvaabhyaamuttaman tribhiruchyate || 45 ||

अंग्रेज़ी अर्थ

Now (atha), in the Sapta-varga [and] Dig-varga [groups] (sapta-varge...digvarge), [yogas] with names (sanjnakaah) beginning with (aadi) Parijata [apply]. Parijata occurs (bhavet) by two [vargas agreeing] (dvaabhyaam); Uttama is called (uchyate) by three (tribhih).

हिन्दी अर्थ

अब (अथ), सप्तवर्ग [तथा] दिग्वर्ग [समूहों] में, पारिजात आदि नाम वाले [योग होते हैं]। दो [वर्गों के मेल] से (द्वाभ्यां) पारिजात होता है; तीन से (त्रिभिः) उत्तम कहा जाता है (उच्यते)।

स्रोत: BPHS Ch.6, verse 45, Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read cleanly from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p87-v45.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुर्भिर्गोपुराख्यं स्यान्छरैः सिंहासनं तथा । पारावतं भवेत् षड्भिर्देवलोकं च सप्तभिः ॥ ४६ ॥

chaturbhirgopuraakhyan syaanchharaih sinhaasanan tathaa | paaraavatan bhavet shadbhirdevalokan cha saptabhih || 46 ||

अंग्रेज़ी अर्थ

By four (chaturbhih), it is (syaat) named (aakhyam) Gopura; by [the bhuta-samkhya numeral-word] "sharaih" [DISCLOSED: "shara" ("arrow"), again the Kama's-five-arrows numeral-word for five, as already seen with "vaana" at verse 32] and likewise (tathaa), Simhasana; it becomes (bhavet) Paravata by six (shadbhih); and (cha) Devaloka by seven (saptabhih).

हिन्दी अर्थ

चार [वर्गों के मेल] से (चतुर्भिः), इसे गोपुर नाम दिया जाता है; "शरैः" [भूतसंख्या शब्द] से [स्पष्टीकरण: "शर" ("बाण"), पुनः कामदेव के पाँच बाणों वाला पाँच की संख्या हेतु शब्द, जैसा श्लोक ३२ में "वाण" के रूप में पहले भी देखा गया] तथा इसी प्रकार (तथा), सिंहासन; छह से (षड्भिः) यह पारावत होता है; तथा (च) सात से (सप्तभिः) देवलोक।

स्रोत: BPHS Ch.6, verse 46, Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read cleanly from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p87-v46.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वसुभिर्ब्रह्मलोकाख्यं नवभिः शक्रवाहनम् । दिग्भिः श्रीधामयोगः स्यादथ षोडशवर्गके ॥ ४७ ॥

vasubhirbrahmalokaakhyan navabhih shakravaahanam | digbhih shriidhaamayogah syaadatha shodashavargake || 47 ||

अंग्रेज़ी अर्थ

By [the bhuta-samkhya numeral-word] "vasubhih" ("by the Vasus", i.e. by eight), it is named Brahmaloka; by nine (navabhih), Shakravahana; by [the numeral-word] "digbhih" ("by the directions", i.e. by ten), it is (syaat) the Shridhama-yoga. Now (atha), [turning to the] Shodasha-varga (sixteen-fold group) [DISCLOSED: the verse names the Shodasha-varga at its close but the naming-scheme details for it, if continued, are not stated within this line and would need to be traced in what follows].

हिन्दी अर्थ

"वसुभिः" [भूतसंख्या शब्द] ("वसुओं द्वारा", अर्थात् आठ) से, इसे ब्रह्मलोक नाम दिया जाता है; नौ से (नवभिः), शक्रवाहन; "दिग्भिः" [शब्द] ("दिशाओं द्वारा", अर्थात् दस) से, यह श्रीधामयोग होता है। अब (अथ), षोडशवर्ग (सोलह वर्गों के समूह) की ओर [स्पष्टीकरण: श्लोक के अन्त में षोडशवर्ग का नाम लिया गया है, परन्तु इसके लिए नामकरण-योजना का विवरण इस पंक्ति में नहीं दिया गया; यह आगे के पाठ में देखना होगा कि क्या यह जारी रहता है]।

स्रोत: BPHS Ch.6, verse 47, Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read cleanly from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p87-v47.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भेदकं च भवेद् द्वाभ्यां त्रिभिः स्यात्कुसुभाख्यकम् । चतुर्भिर्नागपुष्पं स्यात् पश्चाभिः कन्दुकाह्वयम् ॥ ४८ ॥

bhedakan cha bhaved dvaabhyaan tribhih syaatkusubhaakhyakam | chaturbhirnaagapushpan syaat pashchaabhih kandukaahvayam || 48 ||

अंग्रेज़ी अर्थ

And (cha) by two [vargas agreeing] (dvaabhyaam), it becomes (bhavet) [named] Bhedaka; by three (tribhih), it is (syaat) named (aakhyakam) [what is printed as] "Kusubha" [DISCLOSED: printed clearly as "कुसुभाख्यकम्" with भ, confirmed at 2x zoom; the expected form is "कुसुमाख्यकम्" (Kusuma, "flower"), and this is a print artifact substituting भ for म -- CONFIRMED by the following page's (PDF p.88, printed page 56) own Hindi commentary table, which states plainly "तीन से कुसुम" ("by three, Kusuma"); the printed letter भ is nonetheless preserved as transcribed in the sanskrit/iast fields, per this project's transcribe-exactly-what-is-printed discipline]; by four (chaturbhih), it is Nagapushpa; by [what is printed as] "pashchaabhih" [DISCLOSED: printed clearly as "पश्चाभिः", confirmed at 2x zoom, where the numbering sequence (2,3,4,-,6...) makes "पञ्चभिः" ("by five") contextually expected instead -- preserved as printed rather than silently corrected], it is called (aahvayam) Kanduka ("ball").

हिन्दी अर्थ

तथा (च) दो [वर्गों के मेल] से (द्वाभ्यां), यह भेदक [नाम] होता है (भवेत्); तीन से (त्रिभिः), इसे "कुसुभ" [मुद्रित नाम] दिया जाता है (आख्यकम्) [स्पष्टीकरण: 2x ज़ूम पर स्पष्ट रूप से भ सहित "कुसुभाख्यकम्" मुद्रित पाया गया; अपेक्षित रूप "कुसुमाख्यकम्" (कुसुम, "फूल") है, और यह भ के स्थान पर म का मुद्रण-दोष है -- इसकी पुष्टि अगले पृष्ठ (पीडीएफ पृ.८८, मुद्रित पृष्ठ ५६) की अपनी हिन्दी टीका-तालिका से होती है, जो स्पष्ट रूप से "तीन से कुसुम" कहती है; फिर भी संस्कृत/IAST क्षेत्रों में मुद्रित अक्षर भ को यथावत् रखा गया है, इस परियोजना की "जो मुद्रित है वही लिखें" नीति के अनुसार]; चार से (चतुर्भिः), यह नागपुष्प होता है; "पश्चाभिः" [मुद्रित शब्द] से [स्पष्टीकरण: 2x ज़ूम पर स्पष्ट रूप से "पश्चाभिः" मुद्रित पाया गया, जहाँ संख्या-क्रम (२,३,४,-,६...) के अनुसार प्रसंगानुसार "पञ्चभिः" ("पाँच से") अपेक्षित है -- मौन सुधार के बजाय मुद्रित रूप में यथावत् रखा गया], इसे कन्दुक ("गेंद") नाम दिया जाता है (आह्वयम्)।

स्रोत: BPHS Ch.6, verse 48, Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p87-v48-full-zoom.png confirming "कुसुभाख्यकम्" with भ at 2x magnification, bphs-p87-v48line3-zoom.png confirming "पश्चाभिः" at 2x magnification). English/Hindi meanings by Vedic Hora -- for review. The "कुसुभ"/"कुसुम" print anomaly is independently confirmed by the following page's own Hindi commentary table entry "तीन से कुसुम" within its full Shodashavarga naming-scheme summary (scratchpad/bphs-p88-tiny.png).

संस्कृत

करेलाख्यं भवेत् षड्भिः सप्तभिः कल्पवृक्षकम् । अष्टभिश्चन्दनवनं नवभिः पूर्णचन्द्रकम् ॥ ४९ ॥

karelaakhyan bhavet shadbhih saptabhih kalpavrukshakam | ashtabhishchandanavanan navabhih puurnachandrakam || 49 ||

अंग्रेज़ी अर्थ

By six (shadbhih), it becomes (bhavet) named Karela; by seven (saptabhih), Kalpavriksha; by eight (ashtabhih), Chandanavana; by nine (navabhih), Purnachandraka.

हिन्दी अर्थ

छह से (षड्भिः), यह करेल नाम होता है (भवेत्); सात से (सप्तभिः), कल्पवृक्ष; आठ से (अष्टभिः), चन्दनवन; नौ से (नवभिः), पूर्णचन्द्रक।

स्रोत: BPHS Ch.6, verse 49, Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p87-v49line1-zoom.png, bphs-p87-v50.png capturing this verse's second line). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दिग्भिरुच्चैःश्रवं नाम रुद्रैर्धन्वन्तरिर्भवेत् । सूर्यकान्तं भवेत् सूर्यैर्विश्वैः स्याद्विद्रुमाख्यकम् ॥ ५० ॥

digbhiruchchaihshravan naama rudrairdhanvantarirbhavet | suuryakaantan bhavet suuryairvishvaih syaadvidrumaakhyakam || 50 ||

अंग्रेज़ी अर्थ

By [the numeral-word] "digbhih" (by ten), [it is] named Ucchaishrava; by [the numeral-word] "rudraih" ("by the Rudras", i.e. by eleven), it becomes (bhavet) Dhanvantari. By [the numeral-word] "suryaih" ("by the Suns/Adityas", i.e. by twelve), it becomes Suryakanta; by [the numeral-word] "vishvaih" ("by the Vishvedevas", i.e. by thirteen), it is (syaat) named (aakhyakam) Vidruma ("coral") [CORRECTION OF A PRIOR DISCLOSURE: this word was first read as "digdhuma" from a lower-magnification crop, with the count implied by "vishvaih" left disclosed as uncertain (ten or thirteen). A subsequent page (PDF p.88, printed page 56) supplied the same edition's own Hindi commentary table, stating explicitly "तेरह से विद्रुम" ("by thirteen, Vidruma") -- confirming both the count (thirteen) and the name. A fresh 4x zoom crop of this verse's closing word (scratchpad/bphs-p87-v50-word-zoom.png) is consistent with "विद्रुमाख्यकम्", the small उ-vowel-mark under र being easy to miss at lower magnification; the reading is now taken as Vidruma on the strength of the commentary's explicit corroboration].

हिन्दी अर्थ

"दिग्भिः" [संख्या-शब्द] (दस) से, [यह] उच्चैःश्रवा नाम वाला होता है; "रुद्रैः" [शब्द] ("रुद्रों द्वारा", अर्थात् ग्यारह) से, यह धन्वन्तरि होता है (भवेत्)। "सूर्यैः" [शब्द] ("सूर्यों/आदित्यों द्वारा", अर्थात् बारह) से, यह सूर्यकान्त होता है; "विश्वैः" [शब्द] ("विश्वेदेवों द्वारा", अर्थात् तेरह) से, यह विद्रुम ("मूँगा") नाम वाला होता है (स्याद्) [पूर्व-प्रकटीकरण का सुधार: इस शब्द को पहले निम्न-आवर्धन क्रॉप से "दिग्धुम" पढ़ा गया था, तथा "विश्वैः" द्वारा सूचित संख्या (दस या तेरह) को अनिश्चित बताया गया था। इसके बाद अगले पृष्ठ (पीडीएफ पृ.८८, मुद्रित पृष्ठ ५६) पर इसी संस्करण की अपनी हिन्दी टीका-तालिका में स्पष्ट रूप से "तेरह से विद्रुम" पाया गया -- जिससे संख्या (तेरह) तथा नाम दोनों की पुष्टि होती है। इस श्लोक के अन्तिम शब्द का एक नया 4x ज़ूम क्रॉप (bphs-p87-v50-word-zoom.png) "विद्रुमाख्यकम्" से संगत है, जहाँ र के नीचे की छोटी उ-मात्रा निम्न आवर्धन पर छूट जाना सम्भव था; टीका की स्पष्ट पुष्टि के आधार पर अब इसे विद्रुम पढ़ा गया है]।

स्रोत: BPHS Ch.6, verse 50 (closing this page's Vargabheda naming-scheme run), Kashi Sanskrit Series No.220, PDF p.87 (printed page 55), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p87-v50.png, and a corrective re-crop scratchpad/bphs-p87-v50-word-zoom.png at 4x magnification); the "विद्रुम" reading is directly corroborated by the following page's (PDF p.88, printed page 56) own Hindi commentary table entry "तेरह से विद्रुम" within its full Shodashavarga naming-scheme summary. The page's CC-0/eGangotri watermark sits in blank space below this verse, not overlapping any verse text. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शक्रसिंहासनं शक्रैर्गोलोकं तिथिभिर्भवेत् । भूपैः श्रीवसभाख्यं स्याद् वर्गाच्छभेदैरुदाहृताः ॥ ५१ ॥

shakrasinhaasanan shakrairgolokan tithibhirbhavet | bhuupaih shriivasabhaakhyan syaad vargaachchhabhedairudaahrutaah || 51 ||

अंग्रेज़ी अर्थ

[This becomes] Shakra-Simhasana, by [the numeral-word] "shakraih" ("by the Shakras/Indras", i.e. by fourteen, per the traditional count of fourteen Indras across the fourteen Manvantaras); Goloka becomes (bhavet) by [the numeral-word] "tithibhih" ("by the tithis", i.e. by fifteen, there being fifteen tithis in a lunar fortnight). By [what is printed as] "bhuupaih" ("by kings") [DISCLOSED: this appears to echo verse 42's "Nripa-vargakaah" ("royal groupings"), tying the culminating sixteenth name back to that opening designation, though the exact grammatical role of "bhuupaih" here was not independently resolved from the verse text alone], it is (syaat) named (aakhyam) [what is printed as] "Shrivasabha" [DISCLOSED: printed clearly as "श्रीवसभाख्यं"; the following page's (PDF p.88, printed page 56) own Hindi commentary confirms the intended name is "श्रीवल्लभ" (Shrivallabha, "beloved of Shri/Lakshmi") for the sixteenth-count yoga -- so this is very likely a print artifact dropping/altering the geminate ल्ल, but the printed letters are preserved as transcribed] -- these [names across verses 43-51] are declared (udaahrutaah) through (i.e. by way of) the distinctions of varga-combination (varga-accha-bhedaih [DISCLOSED: the compound's exact segmentation was not fully resolved, but its sense -- "through the varga-combination distinctions" -- is clear from context and closes the Vargabheda naming-scheme run]).

हिन्दी अर्थ

"शक्रैः" [भूतसंख्या शब्द] ("शक्रों/इन्द्रों द्वारा", अर्थात् चौदह, परम्परा अनुसार चौदह मन्वन्तरों में चौदह इन्द्र होने के कारण) से, [यह] शक्र-सिंहासन होता है; "तिथिभिः" [शब्द] ("तिथियों द्वारा", अर्थात् पन्द्रह, एक पक्ष में पन्द्रह तिथियाँ होने के कारण) से, गोलोक होता है (भवेत्)। "भूपैः" [मुद्रित शब्द] ("राजाओं द्वारा") से [स्पष्टीकरण: यह श्लोक ४२ के "नृपवर्गकाः" ("राजयोग्य समूह") की प्रतिध्वनि प्रतीत होता है, जो अन्तिम सोलहवें नाम को उस आरम्भिक नामकरण से जोड़ता है, यद्यपि यहाँ "भूपैः" की ठीक व्याकरणिक भूमिका केवल श्लोक-पाठ से स्वतन्त्र रूप से निश्चित नहीं हो सकी], इसे [मुद्रित] "श्रीवसभ" नाम दिया जाता है (आख्यं) [स्पष्टीकरण: "श्रीवसभाख्यं" स्पष्ट रूप से मुद्रित है; अगले पृष्ठ (पीडीएफ पृ.८८, मुद्रित पृष्ठ ५६) की अपनी हिन्दी टीका पुष्टि करती है कि सोलह-संख्या वाले योग का अभिप्रेत नाम "श्रीवल्लभ" है -- अतः यह सम्भवतः द्वित्व ल्ल के लुप्त/परिवर्तित होने का मुद्रण-दोष है, परन्तु मुद्रित अक्षर यथावत् रखे गए हैं] -- ये [नाम, श्लोक ४३-५१ में] वर्ग-संयोग के भेदों द्वारा कहे गए हैं (उदाहृताः) [स्पष्टीकरण: संयुक्त पद का ठीक विभाजन पूर्णतः निश्चित नहीं हो सका, परन्तु प्रसंग से इसका अर्थ -- "वर्ग-संयोग के भेदों द्वारा" -- स्पष्ट है, तथा यह वर्गभेद नामकरण-योजना के इस क्रम को समाप्त करता है]।

स्रोत: BPHS Ch.6, verse 51 (closing the Vargabheda naming-scheme run at fourteen and fifteen vargas, then naming the sixteenth), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.88 (printed page 56, chapter header "बृहत्पाराशरहोराशास्त्रम्"). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p88-v51-word1-zoom.png and bphs-p88-v51-word2-zoom.png at 3x confirming "शक्रसिंहासनं" and "...क्रैगोलोकं", bphs-p88-v51-line2-zoom2.png at 1.8x confirming line 2). Directly corroborated by the same page's Hindi commentary table ("चौदह से शक्र-सिंहासन पन्द्रह से गोलोक, सोलह से श्रीवल्लभ, नाम होते हैं"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वोच्चमूलत्रिकोणस्व-भवनाधिपतेस्तथा । स्वारूढात् केन्द्रनाथानां वार्गो ग्राह्याः सुधीमता ॥ ५२ ॥

svocchamuulatrikonasva-bhavanaadhipatestathaa | svaaruudhaat kendranaathaanaan vaargo graahyaah sudhiimataa || 52 ||

अंग्रेज़ी अर्थ

Of the lord of [a planet's] own exaltation (sva-uchcha), own-mulatrikona (muula-trikona), and own-house (sva-bhavana), and likewise (tathaa) of the lords of the kendras (angular houses) counted from [that planet's] own navamsha-ascendant (sva-aaruudhaat) [DISCLOSED: "svaaruudhaat" here most plausibly refers to the planet's own placement/arudha in the navamsha or other varga chart, rather than the technical Arudha-lagna of chapter-later fame; this is inferred from context, not stated more explicitly in this half-verse] -- [what is printed as] "vaargo" [DISCLOSED: printed "वार्गो" where the grammatically-expected plural "वर्गाः" ("the vargas [of these]") would fit the sentence; likely a print artifact, preserved as transcribed] is/are to be taken (graahyaah) as auspicious, by the wise (sudhiimataa).

हिन्दी अर्थ

[किसी ग्रह की] अपनी उच्च-राशि, मूलत्रिकोण, तथा स्वराशि के स्वामी के, तथा इसी प्रकार (तथा) [उस ग्रह के] अपने नवांश-आरूढ़ से (स्वारूढात्) [स्पष्टीकरण: यहाँ "स्वारूढात्" का अभिप्राय सम्भवतः उस ग्रह की अपनी नवांश या अन्य वर्ग-कुण्डली में स्थिति/आरूढ़ से है, न कि आगे प्रसिद्ध होने वाले तकनीकी अरूढ़-लग्न से; यह प्रसंग से अनुमानित है, इस अर्ध-श्लोक में इससे अधिक स्पष्ट नहीं कहा गया] केन्द्रों के स्वामियों के [मुद्रित] "वार्गो" [स्पष्टीकरण: "वार्गो" मुद्रित है जहाँ व्याकरणतः अपेक्षित बहुवचन "वर्गाः" ("इनके वर्ग") इस वाक्य में अधिक उपयुक्त बैठता है; सम्भवतः मुद्रण-दोष, मुद्रित रूप में यथावत् रखा गया] विद्वानों द्वारा ग्राह्य (शुभ) माने जाते हैं (सुधीमता)।

स्रोत: BPHS Ch.6, verse 52, Kashi Sanskrit Series No.220, PDF p.88 (printed page 56), read cleanly from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p88-v52-word2-zoom.png at 3x confirming "स्वोच्चमूलत्रिकोण" -- correcting an initial lower-zoom misreading of "मूल" as "सूल" -- and bphs-p88-v52-varga-zoom.png at 3x confirming "वार्गो ग्राह्याः"). Directly corroborated by the page's Hindi commentary ("इनमें अपने उच्च, मूलत्रिकोण, स्वराशि के स्वामियों के तथा लग्नपद से केन्द्राधीशों के वर्ग ग्राह्य (शुभ) होते हैं"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अस्तंगता ग्रहाजिता नीचगा दुर्बलास्तथा । शयनादिगता दुःस्था ग्रहाः स्युर्योगनाशकाः ॥ ५३ ॥

astangataa grahaajitaa niichagaa durbalaastathaa | shayanaadigataa duhsthaa grahaah syuryoganaashakaah || 53 ||

अंग्रेज़ी अर्थ

Planets (grahaah) that are combust (astangataa, lit. "gone to setting", i.e. too close to the Sun), [what is printed as] "grahaajitaa" ("defeated by [another] planet", i.e. losing planetary war) [DISCLOSED: printed with a long vowel as "ग्रहाजिता" rather than the more commonly expected "ग्रहजिता"; preserved as transcribed], gone to debilitation (niichagaa) [DISCLOSED: the vowel-mark over the initial न् was not fully crisp at this crop's resolution and could resemble a chandrabindu rather than a clean दीर्घ ई-matra; "niichagaa" ("debilitated") is retained as the near-certain intended reading, both grammatically and from context (it fits naturally alongside the surrounding list of weak-planet conditions)], and likewise (tathaa) weak (durbalaah) -- [planets] gone to "shayana" and other [such states, e.g. "sleeping"/dormant planetary states] (shayana-aadi-gataa), [or] badly placed (duhsthaa) -- these become (syuh) the destroyers of the [auspicious] yogas (yoga-naashakaah) [described in verses 43-51].

हिन्दी अर्थ

जो ग्रह (ग्रहाः) अस्तंगत (अस्तंगता, अर्थात् सूर्य के अत्यधिक निकट) हों, [मुद्रित] "ग्रहाजिता" ("[अन्य] ग्रह द्वारा पराजित", अर्थात् ग्रहयुद्ध में हारा हुआ) [स्पष्टीकरण: यहाँ दीर्घ स्वर सहित "ग्रहाजिता" मुद्रित है, न कि अधिक सामान्यतः अपेक्षित "ग्रहजिता"; यथावत् रखा गया], नीचगा (नीचगत, अर्थात् नीच राशि में स्थित) [स्पष्टीकरण: इस क्रॉप के रिज़ॉल्यूशन पर आरम्भिक न् के ऊपर का स्वर-चिह्न पूर्णतः स्पष्ट नहीं था और चन्द्रबिन्दु जैसा भी दिख सकता था, न कि शुद्ध दीर्घ ई-मात्रा; "नीचगा" ("नीचस्थ") को ही निकटतम निश्चित पाठ माना गया है, यह व्याकरण तथा प्रसंग दोनों से मेल खाता है (आसपास की दुर्बल-ग्रह अवस्थाओं की सूची में स्वाभाविक रूप से बैठता है)], तथा इसी प्रकार (तथा) दुर्बल (दुर्बला) हों -- शयनादि अवस्था को प्राप्त (शयनादिगता, अर्थात् "शयन" आदि जैसी सुप्त/निष्क्रिय ग्रह-अवस्थाओं में), अथवा दुःस्थ (दुःस्था, अर्थात् बुरे भाव में स्थित) हों -- ऐसे ग्रह [श्लोक ४३-५१ में वर्णित शुभ] योगों के नाशक होते हैं (स्युः)।

स्रोत: BPHS Ch.6, verse 53 (closing verse of the Vargabheda subsection and of Chapter 6, immediately followed by the editorial colophon "इति...षोडशवर्गवर्णनाध्यायः समाप्तः ॥ ६ ॥"), Kashi Sanskrit Series No.220, PDF p.88 (printed page 56), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p88-v53-line1-zoom2.png and bphs-p88-v53-word23-zoom.png at 3x, bphs-p88-v53-line1-zoom.png capturing line 2). Directly corroborated by the page's Hindi commentary ("अस्तंगत...ग्रहों के द्वारा पराजित, नीचगत, निर्बल, तथा शयनादि दुरवस्थागत ग्रहों के वर्ग अशुभकारक एवं उपर्युक्त योगों के नाशक होते हैं") and the commentary's own closing verse-range marker "॥ ४२-५३ ॥", confirming that the Vargabheda subsection (and Chapter 6 itself) runs through this verse. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ षोडशवर्गेषु विवृणोमि विवेचनम् । लग्ने देहस्य विज्ञानं होरायां सम्पदादिकम् ॥ १ ॥

atha shodashavargeshu vivrunomi vivechanam | lagne dehasya vijnaanan horaayaan sampadaadikam || 1 ||

अंग्रेज़ी अर्थ

Now (atha) I explain (vivrunomi) the discrimination/examination (vivechanam) among the sixteen vargas (shodasha-vargeshu). In the Lagna (the birth-ascendant, D-1), the knowledge (vijnaanam) of the body (dehasya); in the Hora (D-2), wealth (sampat) and the like (aadikam).

हिन्दी अर्थ

अब (अथ) मैं सोलह वर्गों (षोडशवर्गेषु) में विवेचन (परीक्षण) कहता हूँ (विवृणोमि)। लग्न (जन्म-लग्न, D-1) में शरीर का ज्ञान (देहस्य विज्ञानम्); होरा (D-2) में धन (सम्पत्) आदि (आदिकम्) का ज्ञान होता है।

स्रोत: BPHS Ch.7 (वर्गविवेचनाध्यायः, "the chapter discriminating/examining the vargas"), verse 1, opening the chapter's own summary of what each of the sixteen vargas (already individually defined across Chapter 6) is used to examine. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.89 (printed page 57), immediately following Chapter 6's colophon on the same page. Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p89-ch7-v1-2.png). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्रेष्काणे भ्रातृजं सौख्यं तुर्याशे भाग्यचिन्तनम् । पुत्रपौत्रादिकानां वै चिन्तनं सप्तमांशके ॥ २ ॥

dreshkaane bhraatrujan saukhyan turyaashe bhaagyachintanam | putrapautraadikaanaan vai chintanan saptamaanshake || 2 ||

अंग्रेज़ी अर्थ

In the Drekkana (D-3), the happiness (saukhyam) arising from brothers (bhraatru-jam); in [what is printed as] "turyaashe" [DISCLOSED: printed "तुर्याशे", lacking the expected anusvara of "तुर्यांशे" (Turyamsha/Chaturthamsha, D-4) -- consistent with this edition's recurring pattern of dropping a nasalization mark; taken as Turyamsha/Chaturthamsha], the consideration (chintanam) of fortune (bhaagya); the consideration, indeed (vai), of sons, grandsons, and the like (putra-pautra-aadikaanaam) [is made] in [what is printed as, per this crop's resolution, a compact conjunct read as] "saptamaanshake" (the Saptamamsha, D-7) [DISCLOSED: the middle conjunct of this word was not fully crisp even at high zoom and could resemble a doubled स; "सप्तमांशके" (Saptamamsha) is taken as the intended and printed reading, strongly confirmed by context -- the Saptamamsha's traditional Parashari signification is precisely children/progeny, matching this line's content exactly].

हिन्दी अर्थ

द्रेष्काण (D-3) में भाइयों से उत्पन्न सुख (भ्रातृजं सौख्यम्); [मुद्रित] "तुर्याशे" [स्पष्टीकरण: "तुर्याशे" मुद्रित है, अपेक्षित अनुस्वार-सहित "तुर्यांशे" (तुर्यांश/चतुर्थांश, D-4) के स्थान पर -- यह इसी संस्करण के अनुनासिक-चिह्न छूटने के आवर्ती प्रतिरूप से मेल खाता है; तुर्यांश/चतुर्थांश के रूप में लिया गया है] में भाग्य का चिन्तन; पुत्र-पौत्र आदि का चिन्तन वै [मुद्रित, इस क्रॉप के रिज़ॉल्यूशन पर, एक सान्द्र संयुक्ताक्षर सहित पढ़ा गया] "सप्तमांशके" (सप्तमांश, D-7) में होता है [स्पष्टीकरण: इस शब्द का मध्य संयुक्ताक्षर उच्च ज़ूम पर भी पूर्णतः स्पष्ट नहीं था और द्वित्व स जैसा भी दिख सकता था; "सप्तमांशके" (सप्तमांश) को अभिप्रेत तथा मुद्रित पाठ माना गया है, जिसकी प्रसंग से प्रबल पुष्टि होती है -- सप्तमांश का पारम्परिक पाराशरी अभिप्राय ठीक सन्तान/पुत्र-पौत्र ही है, जो इस पंक्ति की विषयवस्तु से पूर्णतः मेल खाता है]।

स्रोत: BPHS Ch.7, verse 2, Kashi Sanskrit Series No.220, PDF p.89 (printed page 57), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p89-ch7-v2b.png, bphs-p89-v2-turyanshe-zoom2.png at 3x for "तुर्याशे", bphs-p89-v2-saptam-zoom3.png at 5x for the Saptamamsha word). The Saptamamsha=children identification is corroborated by the well-established Parashari varga-signification scheme (also consistent with the traditional pairing seen in verse 3's continuation to the ninth, tenth, and twelfth vargas). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नवमांशे कलत्राणां दशमांशे महत् पलम् । द्वादशांशे तथा पित्रोश्चिन्तनं षोडशांशके ॥ ३ ॥

navamaanshe kalatraanaan dashamaanshe mahat palam | dvaadashaanshe tathaa pitroshchintanan shodashaanshake || 3 ||

अंग्रेज़ी अर्थ

In the Navamsha (D-9), [the consideration] of spouses/wives (kalatraanaam); in the Dashamsha (D-10), great (mahat) [what is printed as] "palam" [DISCLOSED: printed "पलम्", where the expected word is "फलम्" (phalam, "result/fruit", i.e. "great result" -- fitting the Dashamsha's traditional signification of career/status/achievement); a zoomed crop confirms a plain प is printed, not the aspirated फ, so this is very likely a print artifact substituting प for फ]; in the Dvadashamsha (D-12), and likewise (tathaa), the consideration (chintanam) of [both] parents (pitroh, dual genitive) -- [these considerations continue] in the Shodashamsha (D-16) [i.e. the sixteenth varga's own signification is given in the next verse].

हिन्दी अर्थ

नवमांश (D-9) में पत्नियों (कलत्राणाम्) का [विचार]; दशमांश (D-10) में महत् (बड़ा) [मुद्रित] "पलम्" [स्पष्टीकरण: "पलम्" मुद्रित है, जहाँ अपेक्षित शब्द "फलम्" (परिणाम/फल, अर्थात् "महान् फल" -- जो दशमांश के पारम्परिक अभिप्राय, कर्म/पद/उपलब्धि, से मेल खाता है) है; ज़ूम किए गए क्रॉप से पुष्टि होती है कि यहाँ सामान्य प मुद्रित है, महाप्राण फ नहीं, अतः यह सम्भवतः प्/फ् के मुद्रण-दोष का उदाहरण है]; द्वादशांश (D-12) में, तथा इसी प्रकार (तथा), दोनों माता-पिता (पित्रोः, द्विवचन षष्ठी) का चिन्तन होता है -- [यह विवेचन] षोडशांश (D-16) में [आगे बढ़ता है, अर्थात् सोलहवें वर्ग का अपना अभिप्राय अगले श्लोक में दिया गया है]।

स्रोत: BPHS Ch.7, verse 3, Kashi Sanskrit Series No.220, PDF p.89 (printed page 57), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p89-v3.png, bphs-p89-v3-phalam-zoom.png at 4x confirming plain प not फ, bphs-p89-v3-line2.png/bphs-p89-v3-line2b.png for line 2). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुखासुखस्य विज्ञानं वाहनानां तथैव च । उपासनाया विज्ञानं साध्यं विंशति भागके ॥ ४ ॥

sukhaasukhasya vijnaanan vaahanaanaan tathaiva cha | upaasanaayaa vijnaanan saadhyan vinshati bhaagake || 4 ||

अंग्रेज़ी अर्थ

The knowledge (vijnaanam) of happiness and unhappiness (sukha-asukhasya), and likewise (tathaiva cha) of vehicles/conveyances (vaahanaanaam) -- [these belong to the Shodashamsha, D-16, continuing from the previous verse]. The knowledge of worship/spiritual practice (upaasanaayaah) is to be accomplished/determined (saadhyam) in the division of twenty (vinshati bhaagake, i.e. the Vimshamsha, D-20).

हिन्दी अर्थ

सुख और दुःख (सुखासुखस्य) का ज्ञान, तथा इसी प्रकार (तथैव च) वाहनों (वाहनानाम्) का ज्ञान -- [ये षोडशांश, D-16 के अन्तर्गत हैं, पिछले श्लोक से चलते हुए]। उपासना (साधना) का ज्ञान बीस के भाग (विंशति भागके, अर्थात् विंशांश, D-20) में सिद्ध होता है (साध्यम्)।

स्रोत: BPHS Ch.7, verse 4, Kashi Sanskrit Series No.220, PDF p.89 (printed page 57), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p89-v4.png, bphs-p89-v4-line2b.png, bphs-p89-v4-bhagake-zoom2.png at 4x confirming "भागके" not a क्र-conjunct misreading). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विद्या या वेद बाहृवंशे भांशे चैव बलावलम् । त्रिंशांशके रिष्टफलं खवेदांशे शुभाशुभम् ॥ ५ ॥

vidyaa yaa veda baahruvanshe bhaanshe chaiva balaavalam | trinshaanshake rishtaphalan khavedaanshe shubhaashubham || 5 ||

अंग्रेज़ी अर्थ

Whatever (yaa) learning/knowledge (vidyaa) there is, [is examined] in [what is printed as] "baahruvanshe" [DISCLOSED: printed "बाहृवंशे", with an unusual ऋ-vowel conjunct ("हृ") where a halant-plus-व ("ह्व") would be expected for the more familiar name "बाह्वंशे" (Bahvamsha, an alternate name for the Chaturvimshamsha, D-24, whose established Parashari signification is precisely learning/education, matching this line exactly) -- taken as a print artifact substituting a vocalic-r matra for the intended conjunct]; and likewise (cha eva), in the "Bhamsha" [DISCLOSED: the Saptavimshamsha, D-27, is elsewhere called Bhamsha/Nakshatramsha; not independently glossed in this verse but identified by its traditional position in the sixteen-varga sequence immediately after Chaturvimshamsha], strength and weakness (balaavalam) [of the native, is known]. In the Trimshamsha (D-30), the result of adversity/misfortune (rishta-phalam); in the Khavedamsha (D-40), what is auspicious and inauspicious (shubha-ashubham).

हिन्दी अर्थ

जो भी (या) विद्या है, [उसकी परीक्षा] [मुद्रित] "बाहृवंशे" में होती है [स्पष्टीकरण: "बाहृवंशे" मुद्रित है, जिसमें एक असामान्य ऋ-स्वर संयुक्ताक्षर ("हृ") है, जहाँ अधिक परिचित नाम "बाह्वंशे" (बाह्वंश, चतुर्विंशांश, D-24 का एक अन्य नाम, जिसका स्थापित पाराशरी अभिप्राय ठीक विद्या/शिक्षा ही है, इस पंक्ति से पूर्णतः मेल खाता है) के लिए हलन्त-सहित व ("ह्व") संयुक्ताक्षर अपेक्षित होता -- इसे अभिप्रेत संयुक्ताक्षर के स्थान पर स्वरित-ऋ मात्रा के मुद्रण-दोष के रूप में लिया गया है]; तथा इसी प्रकार (चैव) "भांश" में [स्पष्टीकरण: सप्तविंशांश, D-27 को अन्यत्र भांश/नक्षत्रांश भी कहा जाता है; इस श्लोक में स्वतन्त्र रूप से स्पष्ट नहीं किया गया, परन्तु सोलह-वर्ग क्रम में चतुर्विंशांश के ठीक बाद की अपनी पारम्परिक स्थिति से पहचाना गया है], बल और अबल (बलावलम्) [जातक का ज्ञात होता है]। त्रिंशांश (D-30) में अरिष्ट-फल; खवेदांश (D-40) में शुभ-अशुभ।

स्रोत: BPHS Ch.7, verse 5, Kashi Sanskrit Series No.220, PDF p.89 (printed page 57), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p89-v5.png, bphs-p89-v5-bahvamshe-zoom.png at 4x for the "हृ" conjunct, bphs-p89-v5-line2.png for line 2). The Chaturvimshamsha=learning identification is directly confirmed by the well-established Parashari varga-signification scheme; Bhamsha as the following (27th) varga is inferred from its standard sequence position. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अक्षवेदविभागे च षष्ट्यंशेऽखिलमीक्षयेत् । यत्र कुत्रापि सम्प्राप्तः क्रूरषष्ट्यंशकाधिपः ॥ ६ ॥

akshavedavibhaage cha shashtyanshe'khilamiikshayet | yatra kutraapi samproaptah kruurashashtyanshakaadhipah || 6 ||

अंग्रेज़ी अर्थ

And (cha) in the division of the Akshavedamsha (D-45) [and] in the Shashtyamsha (D-60), one should examine (iikshayet) everything (akhilam) -- wherever (yatra kutraapi), a malefic (kruura) becomes (samproaptah, "is obtained/arrived at") lord of the Shashtyamsha (shashtyanshaka-adhipah) -- [CORRECTION OF A PRIOR DISCLOSURE: this entry previously stated that the verse "ends here without an explicit consequence-clause" and offered a speculative reading. Verse 7, on the immediately following page, supplies the consequence directly and explicitly ("tatra naasho na sandeho, mune! vidhivacho yathaa" -- "there, O sage, there is no doubt of destruction, as per the scriptural injunction"): the matters governed by that varga are destroyed. Verses 6-7 together form one continuous statement; the disclosure here is corrected accordingly. See ref 7.7 for the consequence clause and its counterpart for a benefic Kalamsha-lord.]

हिन्दी अर्थ

और (च) अक्षवेदांश (D-45) के विभाग में, [तथा] षष्ट्यंश (D-60) में, सम्पूर्ण (अखिलम्) की परीक्षा करनी चाहिए (ईक्षयेत्) -- जहाँ कहीं भी (यत्र कुत्रापि), कोई पापग्रह (क्रूर) षष्ट्यंश का स्वामी (षष्ट्यंशकाधिपः) हो जाए (सम्प्राप्तः, "प्राप्त हो जाए") -- [पूर्व-प्रकाशित स्पष्टीकरण का सुधार: इस प्रविष्टि में पहले कहा गया था कि श्लोक "बिना किसी स्पष्ट परिणाम-वाक्य के यहीं समाप्त होता है" और एक अनुमानित अर्थ दिया गया था। अगले ही पृष्ठ पर स्थित श्लोक ७ इसका परिणाम प्रत्यक्ष एवं स्पष्ट रूप से देता है ("तत्र नाशो न सन्देहो मुने! विधिवचो यथा" -- "वहाँ, हे मुने! विधि-वचन के अनुसार, नाश होने में कोई सन्देह नहीं है"): उस वर्ग द्वारा शासित विषयों का नाश हो जाता है। श्लोक ६-७ मिलकर एक ही सतत कथन बनाते हैं; तदनुसार यहाँ का स्पष्टीकरण सुधारा गया है। शुभ कलांशाधिप के लिए इसके समानान्तर परिणाम हेतु सन्दर्भ ७.७ देखें।]।

स्रोत: BPHS Ch.7, verse 6, closing the chapter's varga-by-varga signification summary (verses 1-6, covering all sixteen vargas from Lagna through Shashtyamsha), Kashi Sanskrit Series No.220, PDF p.89 (printed page 57), read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p89-v6.png, bphs-p89-v6-line2.png, bphs-p89-v6-kutrapi-zoom.png and bphs-p89-v6-krura-full.png at 2.5x confirming "क्रूरषष्ट्यंशकाधिपः"). CORRECTED: an earlier version of this entry speculated that the half-line ended without a consequence-clause; verse 7 (PDF p.90, printed page 58), read and confirmed at high zoom, supplies that consequence directly, so verses 6-7 are one continuous statement -- see ref 7.7. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तत्र नाशो न सन्देहो मुने ! विधिवचो यथा । यत्र कुत्रापि सम्प्राप्तः कलांशाधिपतिः शुभः ॥ ७ ॥

tatra naasho na sandeho mune ! vidhivacho yathaa | yatra kutraapi samproaptah kalaanshaadhipatih shubhah || 7 ||

अंग्रेज़ी अर्थ

There (tatra, i.e. in the matters governed by that varga), there is destruction (naashah), no doubt (na sandehah) of it, O sage (mune) -- as per the scriptural injunction (vidhivachah yathaa). [This completes, as one continuous statement, the warning begun in verse 6 about a malefic becoming lord of the Shashtyamsha.] Wherever (yatra kutraapi), a benefic (shubhah) becomes (samproaptah) lord of the Kalamsha (kalaansha-adhipatih) [the counterpart, favorable consequence is given in the next verse].

हिन्दी अर्थ

वहाँ (तत्र, अर्थात् उस वर्ग द्वारा शासित विषयों में), नाश होता है (नाशो), इसमें कोई सन्देह नहीं (न सन्देहो), हे मुने (मुने)! -- जैसा कि विधि-वचन में कहा गया है (विधिवचो यथा)। [इस प्रकार श्लोक ६ में आरम्भ की गई चेतावनी -- कि पापग्रह षष्ट्यंशाधिप हो जाए तो क्या होता है -- यहाँ एक सतत कथन के रूप में पूर्ण होती है।] जहाँ कहीं भी (यत्र कुत्रापि), कोई शुभग्रह (शुभः) कलांश का स्वामी (कलांशाधिपतिः) हो जाए (सम्प्राप्तः) [इसका अनुकूल परिणाम अगले श्लोक में दिया गया है]।

स्रोत: BPHS Ch.7, verse 7, opening the chapter's next page, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.90 (printed page 58). Read from a standard 600dpi full-page render and zoom crops (scratchpad/bphs-p90-v7.png, bphs-p90-v7-line2.png, bphs-p90-v7-kalamsha-zoom.png confirming "कलांशाधिपतिः"). This verse directly resolves the consequence-clause that ref 7.6 had previously disclosed as missing from its own half-line -- see the correction applied there. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तत्र वृद्धिश्च पुष्टिश्च गर्गादीनां वचो यथा । इति षोडशवर्गाणां भेदास्ते प्रतिपादिताः ॥ ८ ॥

tatra vriddhishcha pushtishcha gargaadiinaan vacho yathaa | iti shodashavargaanaan bhedaaste pratipaaditaah || 8 ||

अंग्रेज़ी अर्थ

There (tatra, i.e. in the matters governed by that varga), [there is] increase (vriddhih) and (cha) nourishment/growth (pushtih) and (cha) -- as per the word (vachah yathaa) of Garga and other [sages] (gargaadiinaam) [an authority named within the root verse itself]. Thus (iti) the distinctions/particulars (bhedaah) of the sixteen vargas (shodashavargaanaam) have been (te) declared/expounded (pratipaaditaah) [closing the topic begun at verse 1].

हिन्दी अर्थ

वहाँ (तत्र, अर्थात् उस वर्ग द्वारा शासित विषयों में), वृद्धि (वृद्धिश्च) और पुष्टि (पुष्टिश्च) होती है -- जैसा कि गर्ग आदि [ऋषियों] का वचन है (गर्गादीनां वचो यथा)। इस प्रकार (इति) सोलह वर्गों (षोडशवर्गाणां) के भेद (भेदास्ते) प्रतिपादित किए जा चुके हैं (प्रतिपादिताः) [इस प्रकार श्लोक १ से आरम्भ हुआ विषय यहाँ पूर्ण होता है]।

स्रोत: BPHS Ch.7, verse 8, closing the varga-by-varga signification topic (verses 1-8), Kashi Sanskrit Series No.220, PDF p.90 (printed page 58). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p90-v8.png, bphs-p90-v8-line2b.png, bphs-p90-v8-itisoda-zoom.png confirming "इति षोडशवर्गाणां"). The name "Garga" is part of the root verse's own text (an authority the verse itself cites), not the modern editor's commentary, and is transcribed accordingly; the editor's own separate Hindi prose commentary on this page (restating the full sixteen-varga scheme) was read only as corroborating context, per the project's copyright-safety discipline, and is not transcribed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

उदयादिषु भावेषु खटस्य भवनेषु वा । विंशोपकबलं वीक्ष्य शुभाशुभफलं दिशेत् ॥ ९ ॥

udayaadishu bhaaveshu khatasya bhavaneshu vaa | vinshopakabalan viikshya shubhaashubhaphalan dishet || 9 ||

अंग्रेज़ी अर्थ

In the bhavas (bhaaveshu) beginning with the Lagna/rising sign (udaya-aadishu), or (vaa) in the [varga-]houses (bhavaneshu) of a planet (khatasya, "of the sky-goer") -- having examined (viikshya) the Vimshopaka [twenty-point] strength (vinshopaka-balam), one should pronounce (dishet) the auspicious or inauspicious result (shubhaashubha-phalam). [This opens a new topic, immediately following the closing of the sixteen-varga signification summary at verse 8.]

हिन्दी अर्थ

उदय (लग्न) आदि भावों में (उदयादिषु भावेषु), अथवा (वा) किसी ग्रह (खटस्य, "आकाशचारी") के [वर्ग-]भवनों में -- विंशोपक (बीस अंकों वाला) बल (विंशोपकबलं) देखकर (वीक्ष्य), शुभ या अशुभ फल (शुभाशुभफलं) कहना चाहिए (दिशेत्)। [यहाँ से एक नया विषय आरम्भ होता है, जो श्लोक ८ में सोलह-वर्ग-कथन के समापन के ठीक बाद आता है।]

स्रोत: BPHS Ch.7, verse 9, opening the "विंशोपक बल" (Vimshopaka Bala, a twenty-point weighted planetary-strength score across the sixteen vargas) topic, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.90 (printed page 58), immediately below the editor's Hindi prose commentary closing the prior topic with its own "॥ १-८ ॥" verse-range marker. Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p90-v9-12-verses.png, bphs-p90-v9-khatasya-zoom.png at 2.5x confirming "खटस्य"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथातः सम्प्रवक्ष्यामि विंशोपकबलं द्विज । यस्य विज्ञानमात्रेण विपाकं दृष्टिगोचरम् ॥ १० ॥

athaatah sampravakshyaami vinshopakabalan dvija | yasya vijnaanamaatrena vipaakan drishtigocharam || 10 ||

अंग्रेज़ी अर्थ

Now (atha), therefore (atah), I shall fully declare (sampravakshyaami) the Vimshopaka Bala, O twice-born one (dvija) -- by the mere knowledge (vijnaana-maatrena) of which (yasya), the outcome/ripening (vipaakam) [of a planet's effects] comes within sight (drishtigocharam, "within the range of vision").

हिन्दी अर्थ

अब (अथ), इसके पश्चात् (अतः), मैं विंशोपक बल (विंशोपकबलं) को पूर्ण रूप से कहूँगा (सम्प्रवक्ष्यामि), हे द्विज (द्विज)! -- जिसके (यस्य) केवल ज्ञान मात्र से (विज्ञानमात्रेण), [ग्रह के फल का] परिपाक (विपाकं) दृष्टिगोचर हो जाता है (दृष्टिगोचरम्, "दृष्टि के दायरे में आ जाता है")।

स्रोत: BPHS Ch.7, verse 10, Kashi Sanskrit Series No.220, PDF p.90 (printed page 58). Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p90-v9-12-verses.png), legible cleanly at 1.4x zoom with no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विंशोपकबलं वीक्ष्यं सूर्यादीनां खचारिणाम् । स्वगृहोच्चे बलं पूर्णं शून्यं तत्सप्तमस्थिते ॥ ११ ॥

vinshopakabalan viikshyan suuryaadiinaan khachaarinaam | svagrihochche balan puurnan shuunyan tatsaptamasthite || 11 ||

अंग्रेज़ी अर्थ

The Vimshopaka Bala is to be examined (viikshyam) for the Sun and the other (suuryaadiinaam) sky-goers (khachaarinaam, i.e. planets) -- in one's own house or exaltation (svagriha-uchche), the strength (balam) is full (puurnam); it is zero (shuunyam) when situated in the seventh from that (tat-saptama-sthite, i.e. in the sign of debilitation, the seventh from exaltation).

हिन्दी अर्थ

विंशोपक बल (विंशोपकबलं) सूर्य आदि (सूर्यादीनां) आकाशचारी ग्रहों (खचारिणाम्) के लिए देखा जाना चाहिए (वीक्ष्यं) -- अपने घर या उच्च में (स्वगृहोच्चे), बल (बलं) पूर्ण होता है (पूर्णं); उससे सातवें स्थान में स्थित होने पर (तत्सप्तमस्थिते, अर्थात् नीच राशि में, जो उच्च से सातवीं है), बल शून्य होता है (शून्यं)।

स्रोत: BPHS Ch.7, verse 11, Kashi Sanskrit Series No.220, PDF p.90 (printed page 58). Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p90-v9-12-verses.png), legible cleanly at 1.4x zoom with no ambiguity; directly corroborated by the page's own Hindi prose commentary immediately below ("अपने घर तथा उच्च में स्थित ग्रह का बल पूर्ण, और उच्च से सप्तम, अर्थात् नीच स्थित उसका बल शून्य होता है"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गृहस्थितिवशाज्ज्ञेयं द्विराश्यधिपतेस्तथा । मध्येऽनुपाततो ज्ञेयमोजयुग्मर्क्षभेदतः ॥ १२ ॥

grihasthitivashaajjneyan dviraashyadhipatestathaa | madhye'nupaatato jneyamojayugmarkshabhedatah || 12 ||

अंग्रेज़ी अर्थ

[The strength] is to be known (jneyam) according to the house-placement (griha-sthiti-vashaat) [of the planet, i.e. its distance from own-sign/exaltation], and (tathaa) likewise for the lord of two signs (dviraashi-adhipateh, i.e. Mercury and Venus, who each rule two signs); in between (madhye) [the extremes of full and zero strength], it is to be known (jneyam) by interpolation (anupaatatah, i.e. by the rule-of-three), according to the distinction (bhedatah) between odd and even (oja-yugma) signs (riksha).

हिन्दी अर्थ

[बल] घर की स्थिति के अनुसार (गृहस्थितिवशात्) जानना चाहिए (ज्ञेयं) [अर्थात् स्वराशि/उच्च से ग्रह की दूरी के अनुसार], तथा (तथा) उसी प्रकार द्विराशि के अधिपति (द्विराश्यधिपतेः, अर्थात् बुध और शुक्र, जो दोनों दो-दो राशियों के स्वामी हैं) के लिए भी; मध्य में (मध्ये) [पूर्ण और शून्य बल की सीमाओं के बीच], अनुपात से (अनुपाततः, अर्थात् त्रैराशिक नियम से), विषम-सम (ओजयुग्म) राशियों (ऋक्ष) के भेद के अनुसार (भेदतः) जानना चाहिए (ज्ञेयम्)।

स्रोत: BPHS Ch.7, verse 12, closing this page's Vimshopaka Bala content (the topic continues onto the next page, which carries the specific per-planet value table per the page's closing Hindi commentary), Kashi Sanskrit Series No.220, PDF p.90 (printed page 58). Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p90-v12-13.png), legible cleanly at 1.4x zoom with no ambiguity; directly corroborated by the page's own Hindi prose commentary immediately below ("लग्न-आदि द्वादश भावों, तथा स्पष्ट ग्रहों के राश्यादि में विंशोपक बल देखकर शुभाशुभ का निर्देश करना चाहिये" and the following paragraph on dviraashyadhipa/Bhauma-aadi planets' strength by rule-of-three). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सूर्यहोराफलं दद्युर्जीवार्कवसुधात्मजाः । चन्द्रास्फुजिदर्कपुत्राश्चन्द्रहोराफलप्रदाः ॥ १३ ॥

suuryahoraaphalan dadyurjiivaarkavasudhaatmajaah | chandraasphujidarkaputraashchandrahoraaphalapradaah || 13 ||

अंग्रेज़ी अर्थ

Jupiter (jiiva), the Sun (arka), and the son of the Earth [Mars] (vasudhaa-aatmajaah) give (dadyuh) the Surya-Hora [Sun-half] result (suurya-horaa-phalam); the Moon, Venus (asphujit), and the son of the Sun [Saturn] (arka-putraah) are the givers (pradaah) of the Chandra-Hora [Moon-half] result (chandra-horaa-phala).

हिन्दी अर्थ

गुरु (जीव), सूर्य (अर्क), और पृथ्वी के पुत्र [मंगल] (वसुधात्मजाः) -- ये सूर्य-होरा (सूर्य-भाग) का फल (सूर्यहोराफलं) देते हैं (दद्युः); चन्द्रमा, शुक्र (अस्फुजित्), और सूर्य के पुत्र [शनि] (अर्कपुत्राः) -- ये चन्द्र-होरा (चन्द्र-भाग) का फल देने वाले (चन्द्रहोराफलप्रदाः) हैं।

स्रोत: BPHS Ch.7, verse 13, opening the Surya-Hora/Chandra-Hora-phala distribution rule, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.91 (printed page 59). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p91-v13-16.png, bphs-p91-v13-dadyur-zoom.png through -zoom4.png at up to 4x, confirming the compound "दद्युर्जीवार्कवसुधात्मजाः" after an initially ambiguous reading was resolved with no genuine print anomaly). Directly corroborated by the page's own Hindi prose commentary on verses 13-16 ("गुरु, सूर्य, भौम ये तीनों सूर्य होरा का फल, और चन्द्र, शुक्र शनैश्चर ये चन्द्र होरा का फल देते हैं"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

फलद्वयं बुधो दद्यात् समे चेन्दोस्तदन्यके । रवेः फलं स्वहोरादौ फलहीनं विरामके ॥ १४ ॥

phaladvayan budho dadyaat same chendostadanyake | raveh phalan svahoraadau phalahiinan viraamake || 14 ||

अंग्रेज़ी अर्थ

Mercury (budhah) gives (dadyaat) both results (phala-dvayam) [i.e. either the Surya-Hora or Chandra-Hora result] -- in an even sign (same), the Moon's [result] (chandoh, i.e. Chandra-Hora), and (cha) in the other [an odd sign] (tat-anyake), [the Sun's result]. The Sun's (raveh) result (phalam) [is full] at the beginning of its own Hora-division (sva-horaa-aadau), [and] without result (phala-hiinam), i.e. zero, at its ending/cessation (viraamake).

हिन्दी अर्थ

बुध (बुधः) दोनों फल (फलद्वयं) देता है (दद्यात्) -- सम राशि में (समे) चन्द्रमा का [फल] (चेन्दोः, अर्थात् चन्द्र-होरा का फल), और (च) दूसरी [विषम राशि] में (तदन्यके) [सूर्य का फल]। सूर्य (रवेः) का फल (फलं) अपने होरा-विभाग के आरम्भ में (स्वहोरादौ) [पूर्ण होता है], [और] अपने अन्त में (विरामके) फलरहित (फलहीनं), अर्थात् शून्य, होता है।

स्रोत: BPHS Ch.7, verse 14, Kashi Sanskrit Series No.220, PDF p.91 (printed page 59). Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p91-v13-16.png), legible cleanly with no ambiguity. Directly corroborated by the page's own Hindi prose commentary ("बुध, सूर्य चन्द्र दोनों के होरा फल देता है। सम राशियों में चन्द्रहोरा फल और विषम राशियों में सूर्यहोराफल विशेषतः होता है। होरा द्रेष्काणादि वर्गों के मध्य भाग में पूर्ण फल, अन्त में शून्य"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मध्येऽनुपातात् सर्वत्र द्रेष्काणेऽपि विचिन्तयेत् । गृहवत्तुर्यभागेऽपि नवांशादावपि स्वयम् ॥ १५ ॥

madhye'nupaataat sarvatra dreshkaane'pi vichintayet | grihavatturyabhaage'pi navaanshaadaavapi svayam || 15 ||

अंग्रेज़ी अर्थ

In the middle [between the extremes] (madhye), everywhere (sarvatra), one should reckon (vichintayet) by proportion/interpolation (anupaataat). Even in the Drekkana (dreshkaane api), [the same rule holds]; likewise (svayam) of its own accord (svayam), just as for the house (griha-vat), even in the Chaturthamsha (turya-bhaage api), and even beginning with the Navamsha and so on (navaansha-aadau api).

हिन्दी अर्थ

मध्य में (मध्ये), [दोनों सीमाओं के बीच में], सर्वत्र (सर्वत्र), अनुपात से (अनुपातात्) फल समझना चाहिए (विचिन्तयेत्)। द्रेष्काण में भी (द्रेष्काणेऽपि) [यही नियम लागू होता है]; उसी प्रकार स्वयं (स्वयम्), घर के समान (गृहवत्), चतुर्थांश में भी (तुर्यभागेऽपि), और नवमांश आदि में भी (नवांशादावपि) [यही समझना चाहिए]।

स्रोत: BPHS Ch.7, verse 15, Kashi Sanskrit Series No.220, PDF p.91 (printed page 59). Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p91-v13-16.png), legible cleanly with no ambiguity. Directly corroborated by the page's own Hindi prose commentary ("मध्यवर्ती किसी स्थान में अनुपात से फल समझना चाहिये। इसी तरह द्रेष्काण, चतुर्थांश, नवमांश, आदि सभी वर्गोंमें फल समझें"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सूर्यः कुजफलं धत्ते भार्गवस्य निशापतिः । त्रिंशांशके विचिन्त्यैवमत्रापि गृहवत् स्मृतम् ॥ १६ ॥

suuryah kujaphalan dhatte bhaargavasya nishaapatih | trinshaanshake vichintyaivamatraapi grihavat smritam || 16 ||

अंग्रेज़ी अर्थ

The Sun (suuryah) bears/gives (dhatte) Mars's (kuja) result (phalam); the lord of the night [Saturn] (nishaapatih) [gives the result] of Venus (bhaargavasya). In the Trimshamsha (trinshaanshake), one should reckon (vichintya) it thus (evam); here too (atra api), it is remembered/prescribed (smritam) [to be] like the house-rule (griha-vat) [closing the topic begun at verse 9].

हिन्दी अर्थ

सूर्य (सूर्यः) मंगल (कुज) के फल को (कुजफलं) धारण करता है (धत्ते) [अर्थात् देता है]; रात्रि के स्वामी [शनि] (निशापतिः) शुक्र (भार्गवस्य) का [फल देता है]। त्रिंशांश में (त्रिंशांशके) इस प्रकार (एवम्) समझना चाहिए (विचिन्त्य); यहाँ भी (अत्रापि), घर के समान (गृहवत्) [फल] स्मरण किया गया है (स्मृतम्) [इस प्रकार श्लोक ९ से आरम्भ हुआ विषय यहाँ पूर्ण होता है]।

स्रोत: BPHS Ch.7, verse 16, closing the Surya-Hora/Chandra-Hora-phala distribution topic (verses 13-16), Kashi Sanskrit Series No.220, PDF p.91 (printed page 59). Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p91-v13-16.png), legible cleanly with no ambiguity. Directly corroborated by the page's own Hindi prose commentary closing with its own "१३-१६" verse-range marker ("त्रिशांश में रवि-मंगल का, चन्द्रमा-शुक्र का फल देते हैं। यहाँ (त्रिशांश में) भी गृहवत् फल समझना चाहिये"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षड्वर्ग:-- लग्नहोराद्रेकाणाङ्घ्र-भागस्त्र्याशका इति । त्रिंशांशसहिताश्चैते षड्वर्गाः विंशकाः क्रमात् ॥ १७ ॥

shadvargah -- lagnahoraadrekaanaanghra-bhaagastryaashakaa iti | trinshaanshasahitaashchaite shadvargaah vinshakaah kramaat || 17 ||

अंग्रेज़ी अर्थ

[Heading, printed by the editor:] The Shad-varga (six-varga) [scheme]:-- Lagna, Hora, Drekkana, [and] "anghra-bhaaga-stryaashakaa" (a compound whose exact division into names is uncertain on this print -- see disclosure below) -- thus (iti); these (ete), together with (sahitaah) the Trimshamsha (trinshaansha), are (cha) the six vargas (shadvargaah), the twenty-point-weighted ones (vinshakaah), in order (kramaat). [DISCLOSURE: the verse's own printed compound in line 1, read via repeated high-zoom crops of the 600dpi scan, most consistently appears as "...द्रेकाणाङ्घ्र-भागस्त्र्याशका..." (Lagna, Hora, Drekkana, then a compound that reads like "anghra-bhaaga" + "stryaashaka"), naming only four or five distinct divisions before Trimshamsha is added in line 2. The page's own Hindi commentary immediately following the verse, however, explicitly and unambiguously glosses the six Shad-varga members as Lagna, Hora, Drekkana, Navamsha, Dwadashamsha, and Trimshamsha, with Vimshopaka weights 6, 2, 4, 5, 2, 1 respectively -- i.e. it names Navamsha and Dwadashamsha, not the "anghra-bhaaga"/"stryaashaka" terms the verse itself appears to print. This discrepancy could not be resolved with confidence even after many targeted zoom crops (see source note), so both readings are preserved here rather than silently reconciled: the verse's own literal Devanagari is transcribed as printed, and the commentary's explicit naming (Navamsha, Dwadashamsha, matching the well-known standard Parashari Shad-varga scheme) is given as the authoritative sense for the six vargas and their weights.]

हिन्दी अर्थ

[संपादक द्वारा मुद्रित शीर्षक:] षड्वर्ग:-- लग्न, होरा, द्रेकाण, [और] "अङ्घ्रभागस्त्र्याशका" (यह संयुक्त पद इस मुद्रण में स्पष्ट रूप से पृथक्-पृथक् नामों में विभाजित नहीं हो सका -- नीचे प्रकटीकरण देखें) -- इति (इस प्रकार); ये (एते), त्रिंशांश (त्रिंशांश) सहित (सहिताः), षड्वर्ग (षड्वर्गाः) हैं, विंशोपक-भारित (विंशकाः), क्रमशः (क्रमात्)। [प्रकटीकरण: श्लोक की पहली पंक्ति में मुद्रित संयुक्त पद को 600dpi स्कैन के अनेक उच्च-ज़ूम क्रॉप्स से बार-बार पढ़ने पर सबसे अधिक सुसंगत रूप से "...द्रेकाणाङ्घ्र-भागस्त्र्याशका..." ही प्रतीत होता है (लग्न, होरा, द्रेकाण, फिर एक ऐसा संयुक्त पद जो "अङ्घ्रभाग" + "स्त्र्याशका" जैसा प्रतीत होता है), जो त्रिंशांश जोड़े जाने से पहले केवल चार या पाँच ही भेद नाम देता प्रतीत होता है। परन्तु इसी पृष्ठ पर श्लोक के ठीक बाद की सम्पादक की हिन्दी टीका स्पष्ट रूप से षड्वर्ग के छः सदस्य लग्न, होरा, द्रेष्काण, नवमांश, द्वादशांश और त्रिंशांश बताती है, जिनके विंशोपक बल क्रमशः ६, २, ४, ५, २, १ हैं -- अर्थात् वह नवमांश और द्वादशांश नाम देती है, न कि श्लोक में दिखने वाले "अङ्घ्रभाग"/"स्त्र्याशका" पद। अनेक लक्षित ज़ूम प्रयासों के बावजूद भी यह विरोधाभास पूर्ण विश्वास के साथ सुलझाया नहीं जा सका (स्रोत-टिप्पणी देखें), अतः दोनों पाठ यहाँ बिना किसी मौन समाधान के सुरक्षित रखे गए हैं: श्लोक का अपना शाब्दिक देवनागरी पाठ मुद्रित रूप में ही transcribe किया गया है, और टीका का स्पष्ट नामकरण (नवमांश, द्वादशांश, जो सुप्रसिद्ध मानक पाराशरी षड्वर्ग योजना से मेल खाता है) छः वर्गों और उनके भारों के प्रामाणिक अर्थ के रूप में दिया गया है।]

स्रोत: BPHS Ch.7, verse 17, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.91 (printed page 59), under the editor's printed heading "षड्वर्ग:--". UNRESOLVED TEXTUAL AMBIGUITY, fully disclosed per the project's zero-fabrication discipline: line 1's compound following "लग्नहोराद्रे(क/ष्क)ाण" was read via more than a dozen progressively targeted zoom crops of the 600dpi render (scratchpad/bphs-p91-v17-zoom.png, -zoom2.png, -word-zoom.png, -mid-zoom.png, -right-zoom.png, -superzoom.png, -turyansha-zoom.png, -word2.png, -preciseword.png, and the alternate clean render bphs-p91-v13-17.png with bphs-p91-v17line1-loc2.png / -super.png), all converging on the same visual reading "...णाङ्घ्र-भागस्त्र्याशका इति" (with an editorial hyphen printed mid-compound) rather than on legible forms of "नवांश"/"द्वादशांश" as named in the immediately following Hindi commentary (scratchpad/bphs-p91-commentary-after17.png: "षड्वर्गं में लग्न, होरा, द्रेष्काण, नवमांश, द्वादशांश और त्रिंशांश ये छः परिगणित होते हैं। इनका विंशोपक बल क्रमशः ६, २, ४, ५, २, १ ये हैं"). Line 2 ("त्रिंशांशसहिताश्चैते षड्वर्गाः, विंशकाः क्रमात्") is legible with no ambiguity and confirms Trimshamsha is added as the sixth/last member. A further unnumbered heading line immediately below the commentary ("रस नेत्राब्धिपक्षाश्विभूमयः--", read via scratchpad/bphs-p91-v18-heading-zoom3.png) appears to be an editorially-inserted bhuta-samkhya (concrete-noun numeral-word) mnemonic for the same six Vimshopaka weights, but decodes imperfectly against the expected 6,2,4,5,2,1 sequence (rasa=6, netra=2, abdhi=4, paksha=2 [expected 5], ashvi=2, bhuumi=1) and carries no verse number of its own -- it is therefore treated as editorial/mnemonic apparatus, read only as further corroborating context per the project's BPHS copyright-safety discipline, and is not transcribed as a separate numbered root verse. English/Hindi meanings by Vedic Hora -- for review; the bracketed disclosure notes in the translation/translationHi fields are original analysis by Vedic Hora, not part of the source text.

संस्कृत

सप्तवर्गः-- सप्तवर्ग के । स सप्तमांशके तत्र विश्वकाः पञ्च लोचनम् ॥ १८ ॥

saptavargah -- saptavarga ke | sa saptamaanshake tatra vishvakaah pancha lochanam || 18 ||

अंग्रेज़ी अर्थ

[Heading, printed by the editor:] The Saptavarga (seven-varga) [scheme]:-- of the Saptavarga. That [Shad-varga], together with the Saptamsha (sa saptamaanshake), there (tatra) the Vimshopaka weight-units (vishvakaah) are five (pancha, i.e. Lagna's weight = 5) [and] "lochanam" ("eye", a bhuta-samkhya numeral-word for two, i.e. Hora's weight = 2). [The remaining five weights continue in verse 19.]

हिन्दी अर्थ

[संपादक द्वारा मुद्रित शीर्षक:] सप्तवर्गः-- सप्तवर्ग के [विषय में]। वह [षड्वर्ग], सप्तमांश सहित (स सप्तमांशके), वहाँ (तत्र) विंशोपक भार-इकाइयाँ (विश्वकाः) पाँच (पञ्च, अर्थात् लग्न का भार = ५) [और] "लोचनम्" ("नेत्र", दो के लिए भूतसंख्या-पद, अर्थात् होरा का भार = २) हैं। [शेष पाँच भार श्लोक १९ में आगे दिए गए हैं।]

स्रोत: BPHS Ch.7, verse 18, opening the Saptavarga (seven-varga) topic -- adding the Saptamsha (D-7) to the six vargas named in verse 17 -- Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.92 (printed page 60), under the editor's printed heading "सप्तवर्गः--". Read from the standard 600dpi full-page render and zoom crop (scratchpad/bphs-p92-v18-19.png), legible with no ambiguity. The bhuta-samkhya decoding (pancha=5, lochanam/"eye"=2) is directly corroborated by the page's own Hindi prose commentary ("सप्तमांश सहित षड्वर्ग सप्तवर्ग है। सप्तवर्ग में विंशोपक बल क्रमशः ५, २, ३, २१/२, ४१/२, २, १ ये हैं"), whose first two values (5, 2) match this verse exactly; the remaining five (3, 2.5, 4.5, 2, 1) are supplied by verse 19. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रयः साधं द्वयं साध्वेदा द्वौ रात्रिनायकः । स्थूलं फलं च संस्थाप्य तत् सूक्ष्मं च ततस्ततः ॥ १९ ॥

trayah saadhan dvayan saadhvedaa dvau raatrinaayakah | sthuulan phalan cha sansthaapya tat suukshman cha tatastatah || 19 ||

अंग्रेज़ी अर्थ

Three (trayah, i.e. Drekkana's weight = 3), "with-a-half two" (saadham dvayam, i.e. two-and-a-half = 2.5, Saptamsha's weight), "with-a-half [four] Vedas" (saadhvedaah, i.e. the four Vedas plus a half = 4.5, Navamsha's weight), two (dvau, Dwadashamsha's weight), [and] the lord of the night [the Moon, a bhuta-samkhya numeral-word for one] (raatri-naayakah, Trimshamsha's weight = 1). Having established (samsthaapya) this (tat) gross (sthoolam) result (phalam), the subtle/fine (sookshmam) [result, specific to each exact position within a varga,] is [to be found] from place to place (tatastatah) by proportion.

हिन्दी अर्थ

तीन (त्रयः, अर्थात् द्रेष्काण का भार = ३), "आधे सहित दो" (साधं द्वयं, अर्थात् ढाई = २.५, सप्तमांश का भार), "आधे सहित [चार] वेद" (साध्वेदा, अर्थात् चार वेद और आधा = ४.५, नवमांश का भार), दो (द्वौ, द्वादशांश का भार), [और] रात्रि का स्वामी [चन्द्रमा, एक के लिए भूतसंख्या-पद] (रात्रिनायकः, त्रिंशांश का भार = १)। इस (तत्) स्थूल (स्थूलं) फल (फलं) को स्थापित करके (संस्थाप्य), प्रत्येक विशेष स्थान का सूक्ष्म (सूक्ष्मं) फल अनुपात से जगह-जगह (ततस्ततः) [जानना चाहिए]।

स्रोत: BPHS Ch.7, verse 19, closing the Saptavarga topic (verses 18-19), Kashi Sanskrit Series No.220, PDF p.92 (printed page 60). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p92-v18-19.png, bphs-p92-v19-zoom-left.png, bphs-p92-v19-zoom-right.png at 2x, confirming "साधं"/"साध्वेदा" as printed without an intervening र). The full bhuta-samkhya sequence across verses 18-19 (5, 2, 3, 2.5, 4.5, 2, 1) is directly and exactly corroborated by the page's own Hindi prose commentary closing with its own "१८-१९" verse-range marker ("सप्तवर्ग में विंशोपक बल क्रमशः ५, २, ३, २१/२, ४१/२, २, १ ये हैं। इन बलों को स्थूल (वर्ग के मध्य स्थानीय) समझ कर तत्तस्थानीय सूक्ष्म फल अनुपात से जानना चाहिए"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दशवर्गादिगंशाढ्याः कलांशाः षष्टिभागकाः । त्रयं क्षेत्रस्य विज्ञेयाः पञ्च-षष्ट्यंशकस्य च ॥ २० ॥ साधैकभागाः शेषाणां विश्वकाः परिकीर्तिताः ॥ २०½ ॥

dashavargaadiganshaadhyaah kalaanshaah shashtibhaagakaah | trayan kshetrasya vijneyaah pancha-shashtyanshakasya cha || 20 || saadhaikabhaagaah sheshaanaan vishvakaah parikiirtitaah || 20 1/2 ||

अंग्रेज़ी अर्थ

The Dashavarga (dashavargaa) is endowed with (aadhyaah) the direction-division [Dashamsha, D-10] (digamsha), the Kalamsha [i.e. the Shodashamsha, D-16, so called from the sixteen "kalaa" digits of the Moon] (kalaanshaah), [and] the sixtieth-parts [Shashtyamsha, D-60] (shashti-bhaagakaah). Three (trayam) is to be known (vijneyaah) for the field [Lagna] (kshetrasya), and (cha) five (pancha) for the Shashtyamsha (shashtyanshakasya). One-and-a-half parts (saadha-eka-bhaagaah) each are declared (parikiirtitaah) [to be] the weight-units (vishvakaah) of the remaining [eight vargas] (sheshaanaam). [The source itself marks this closing half-line as an appended "20-20half" ("२०-२०½") verse-range in its own commentary.]

हिन्दी अर्थ

दशवर्ग (दशवर्गा) दिक्-विभाग [दशांश, D-10] (दिगंश) से युक्त है (आढ्याः), कलांश [अर्थात् षोडशांश, D-16, चन्द्रमा की सोलह "कला" अंकों से ऐसा नामित] (कलांशाः), [और] षष्टिभाग [षष्ट्यंश, D-60] (षष्टिभागकाः) से भी। क्षेत्र (लग्न) के लिए तीन (त्रयं) जानना चाहिए (विज्ञेयाः), और (च) षष्ट्यंश (षष्ट्यंशकस्य) के लिए पाँच (पञ्च)। शेष [आठ वर्गों] (शेषाणां) की भार-इकाइयाँ (विश्वकाः) प्रत्येक डेढ़-डेढ़ भाग (साधैकभागाः) घोषित की गई हैं (परिकीर्तिताः)। [स्रोत स्वयं इस समापन अर्ध-पंक्ति को अपनी टीका में "२०-२०½" श्लोक-सीमा के रूप में चिह्नित करता है।]

स्रोत: BPHS Ch.7, verse 20 (with its appended half-verse, marked by the source's own commentary as "20-20½"), closing the Dashavarga (ten-varga) topic, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.92 (printed page 60). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p92-v20.png, bphs-p92-v20-l1-left.png/-right.png at 1.8x, bphs-p92-v20half-zoom.png at 2x confirming "साधैकभागाः"). Directly and fully corroborated by the page's own Hindi prose commentary closing with its own "२०-२०½" verse-range marker ("दिगंश, षोडशांश, षष्ट्यंश-युक्त-सप्तवर्ग दशवर्ग होते हैं। ... इनमें क्षेत्र (लग्न) का विंशोपक बल ३, ... षष्ट्यंश का ५, शेष होरा द्रेष्काण आदि आठो वर्ग में १½, १½ होते हैं"), which also confirms the ten members by name (लग्न, होरा, द्रेष्काण, नवांश, द्वादशांश, त्रिंशांश, सप्तमांश, दशमांश, षोडशांश, षष्ट्यंश). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षोडशवर्गं-- अथ वक्ष्ये विशेषेण विश्वकां मम सम्मताम् ॥ २१ ॥

shodashavargan -- atha vakshye visheshena vishvakaan mama sammataam || 21 ||

अंग्रेज़ी अर्थ

[Heading, printed by the editor:] The Shodashavarga (sixteen-varga) [scheme]:-- Now (atha) I shall declare (vakshye) in particular/detail (visheshena) the weight-units (vishvakaan) approved (sammataam) by me (mama) [i.e. the author's own preferred Shodashavarga weight-scheme, as distinct from the Saptavarga/Dashavarga schemes just given].

हिन्दी अर्थ

[संपादक द्वारा मुद्रित शीर्षक:] षोडशवर्गं-- अब (अथ) मैं विशेष रूप से (विशेषेण) अपने द्वारा अनुमोदित (मम सम्मताम्) भार-इकाइयों (विश्वकां) को कहूँगा (वक्ष्ये) [अर्थात्, अभी दिए गए सप्तवर्ग/दशवर्ग योजनाओं से भिन्न, लेखक की अपनी पसन्दीदा षोडशवर्ग भार-योजना]।

स्रोत: BPHS Ch.7, verse 21, opening the Shodashavarga (sixteen-varga) topic under the editor's printed heading "षोडशवर्गं--" (note: printed with an anusvara-like mark, not a visarga, unlike the "सप्तवर्गः--"/"दशवर्गः" headings seen earlier on this page), Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.92 (printed page 60). Read from the standard 600dpi full-page render and precise zoom crops (scratchpad/bphs-p92-v21-heading-super2.png at 4x for the heading, scratchpad/bphs-p92-v21h-a/b/c.png for the verse line), legible with no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

क्रमात् षोडशवर्गाणां क्षेत्रादीनां पृथक् पृथक् । होरा-त्रिंशांश-द्रक्काणे कुचन्द्र शशिनः क्रमात् ॥ २२ ॥

kramaat shodashavargaanaan kshetraadiinaan prithak prithak | horaa-trinshaansha-drakkaane kuchandra shashinah kramaat || 22 ||

अंग्रेज़ी अर्थ

In order (kramaat), for each (prithak prithak) of the sixteen vargas (shodashavargaanaam) beginning with the field [Lagna] (kshetra-aadiinaam) [I shall give the weight] -- in the Hora, Trimshamsha [and] Drekkana (horaa-trinshaansha-drakkaane), respectively (kramaat), [the weight is] "earth" (ku, a bhuta-samkhya numeral-word for one, there being only one earth), "moon" (chandra, one moon) [and] "moon" (shashinah, one moon) -- i.e. one, one, one.

हिन्दी अर्थ

क्रम से (क्रमात्), क्षेत्र (लग्न) आदि (क्षेत्रादीनां) सोलह वर्गों (षोडशवर्गाणां) में से प्रत्येक (पृथक् पृथक्) के लिए [भार बताऊँगा] -- होरा, त्रिंशांश, द्रेक्काण में (होरा-त्रिंशांश-द्रक्काणे), क्रमशः (क्रमात्), "कु" (पृथ्वी, एक के लिए भूतसंख्या-पद, क्योंकि पृथ्वी एक ही है), "चन्द्र" (एक चन्द्रमा) [और] "शशिनः" (एक चन्द्रमा) -- अर्थात् एक, एक, एक।

स्रोत: BPHS Ch.7, verse 22, naming the Shodashavarga members in order and opening the weight-list with a triple bhuta-samkhya encoding of "one" (ku=earth=1, chandra=moon=1, shashinah=moon=1) for Hora, Trimshamsha and Drekkana, Kashi Sanskrit Series No.220, PDF p.92 (printed page 60). Read from the standard 600dpi full-page render and precise zoom crops (scratchpad/bphs-p92-v22line2.png split into -a/-b/-c.png at 2x, confirming "होरा-त्रिंशांश-द्रक्काणे कुचन्द्र शशिनः क्रमात्" letter-by-letter with no overlap-duplication). Directly and fully corroborated by the page's own Hindi prose commentary ("होरा, त्रिंशांश, द्रेक्काण में क्रमशः १,१,१ बल"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कलांशस्य द्वयं ज्ञेयं त्रयं नन्दांशकस्य च । क्षेत्रे सार्धत्रयं, वेदाः स्मृताः षष्ट्यंशकस्य हि ॥ २३ ॥

kalaanshasya dvayan jneyan trayan nandaanshakasya cha | kshetre saardhatrayan, vedaah smritaah shashtyanshakasya hi || 23 ||

अंग्रेज़ी अर्थ

Two (dvayam) is to be known (jneyam) for the Kalamsha [i.e. Shodashamsha, D-16] (kalaanshasya), and (cha) three (trayam) for the Nandamsha [i.e. Navamsha, D-9, "the joy-division"] (nandaanshakasya). In the field [Lagna] (kshetre), three-and-a-half (saardha-trayam); "the Vedas" (vedaah, a bhuta-samkhya numeral-word for four) are remembered/declared (smritaah) indeed (hi) for the Shashtyamsha [D-60] (shashtyanshakasya) -- [DISCLOSED DISCREPANCY: the verse's own printed word here is unambiguously "शष्ट्यंशकस्य"/"षष्ट्यंशकस्य" ("of the Shashtyamsha", D-60), confirmed at high zoom with no ambiguity; however, the page's own Hindi prose commentary immediately below instead assigns this same value of four to the Saptamsha (D-7) ("सप्तमांश में ४"), not the Shashtyamsha, and does not separately mention a Saptamsha weight elsewhere in its list. This mirrors the kind of verse-vs-commentary naming discrepancy already disclosed at ref 7.17, and is preserved here rather than silently corrected in either direction.]

हिन्दी अर्थ

कलांश [अर्थात् षोडशांश, D-16] (कलांशस्य) के लिए दो (द्वयं) जानना चाहिए (ज्ञेयं), और (च) नन्दांश [अर्थात् नवमांश, D-9, "आनन्द-विभाग"] (नन्दांशकस्य) के लिए तीन (त्रयं)। क्षेत्र (लग्न) में (क्षेत्रे), साढ़े तीन (सार्धत्रयं); षष्ट्यंश [D-60] (षष्ट्यंशकस्य) के लिए निश्चय ही (हि) "वेदाः" (चार के लिए भूतसंख्या-पद) स्मरण किए गए हैं (स्मृताः) -- [प्रकट की गई विसंगति: श्लोक का स्वयं का मुद्रित शब्द यहाँ स्पष्ट रूप से "षष्ट्यंशकस्य" ("षष्ट्यंश का", D-60) है, जो उच्च ज़ूम पर बिना किसी संदेह के पुष्ट है; परन्तु पृष्ठ की अपनी हिन्दी गद्य टीका, ठीक नीचे, इसी मान चार को इसके बजाय सप्तमांश (D-7) को देती है ("सप्तमांश में ४"), षष्ट्यंश को नहीं, और अपनी सूची में कहीं और अलग से सप्तमांश का भार नहीं बताती। यह ठीक उसी प्रकार की श्लोक-बनाम-टीका नामकरण विसंगति है जो पहले से ही सन्दर्भ ७.१७ में प्रकट की जा चुकी है, और यहाँ इसे किसी भी दिशा में चुपचाप सुधारे बिना संरक्षित रखा गया है।]

स्रोत: BPHS Ch.7, verse 23, Kashi Sanskrit Series No.220, PDF p.92 (printed page 60). Read from the standard 600dpi full-page render and precise zoom crops (scratchpad/bphs-p92-shod2-left.png for the overview, scratchpad/bphs-p92-v23-word-zoom2.png at 3x definitively confirming "स्मृताः षष्ट्यंशकस्य" with no ambiguity). The commentary's conflicting assignment of this value to the Saptamsha instead is read from scratchpad/bphs-p92-comm-left.png / -right.png ("षोडशांश में २, नवमांश में ३, क्षेत्र (गृह) में ३½, सप्तमांश में ४"). Both readings are preserved per the project's zero-fabrication disclosure discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अर्धमर्धं च शेषाणां ह्येतत् स्वीयमुदाहृतम् । पूर्णं विश्वावलं विंशोघृतिः स्यादधिमित्रके ॥ २४ ॥

ardhamardhan cha sheshaanaan hyetat sviiyamudaahritam | puurnan vishvaavalan vinshoghritih syaadadhimitrake || 24 ||

अंग्रेज़ी अर्थ

And (cha) one-half each (ardham ardham) for the remaining [five vargas] (sheshaanaam) -- this indeed (hi etat) is declared (udaahritam) [to be] their own [weight] (sviiyam) [when the planet occupies its own sign in that varga]. The full (puurnam) Vimshopaka strength (vishvaavalam) -- "vinshoghritih" [an unusual compound, literally suggesting something like "the twenty-fold firmness/measure"; transcribed exactly as printed] -- would be (syaat) in a great friend's [sign] (adhimitrake). [DISCLOSED DISCREPANCY, found on re-checking against the very next page: the following page's own closing Hindi commentary gives a numeric summary of five DISTINCT Vimshopaka totals by sign-relationship -- own/great-friend ("मित्रवर्ग") = 18, friend = 15, neutral = 10, enemy = 7, greater-enemy = 5. This does not cleanly match a literal reading of "vinshoghritih" as "twenty" for the great-friend's sign (the commentary's own figure there is 18, not 20); the word's precise intended numeral is therefore uncertain beyond what is printed, and is not silently corrected to 18 or 20 here.]

हिन्दी अर्थ

और (च) शेष [पाँच वर्गों] (शेषाणां) में से प्रत्येक के लिए आधा-आधा (अर्धमर्धं) -- यह निश्चय ही (ह्येतत्) उनका अपना [भार] (स्वीयम्) घोषित किया गया है (उदाहृतम्) [अर्थात् जब ग्रह उस वर्ग में अपनी ही राशि में हो]। पूर्ण (पूर्णं) विंशोपक बल (विश्वावलं) -- "विंशोघृतिः" [एक असामान्य समास, शाब्दिक रूप से "बीस-गुना दृढ़ता/माप" जैसा कुछ सुझाता है; ठीक वैसे ही लिखा गया है जैसे मुद्रित है] -- अधिमित्र [राशि] में (अधिमित्रके) होगा (स्यात्)। [प्रकट की गई विसंगति, अगले पृष्ठ की जाँच से मिली: अगले पृष्ठ की अपनी हिन्दी टीका राशि-संबंध के अनुसार पाँच भिन्न-भिन्न विंशोपक कुल-योग देती है -- स्वराशि/परम-मित्र ("मित्रवर्ग") = १८, मित्र = १५, सम = १०, शत्रु = ७, परम-शत्रु = ५। इससे "विंशोघृतिः" को परम-मित्र राशि के लिए "बीस" के रूप में सीधे पढ़ना मेल नहीं खाता (टीका का अपना आँकड़ा वहाँ १८ है, २० नहीं); अतः इस शब्द का ठीक-ठीक तात्पर्य अनिश्चित है, और यहाँ इसे चुपचाप १८ या २० में सुधारा नहीं गया है।]

स्रोत: BPHS Ch.7, verse 24, Kashi Sanskrit Series No.220, PDF p.92 (printed page 60). Read from the standard 600dpi full-page render and precise zoom crops (scratchpad/bphs-p92-v24l1-a/b/c.png and bphs-p92-v24l2-a/b/c.png at 2x), confirming "अर्धमर्धं च शेषाणां ह्येतत् स्वीयमुदाहृतम्" and "पूर्णं विश्वावलं विंशोघृतिः स्यादधिमित्रके" letter-by-letter with no ambiguity in the printed characters themselves; the word "विंशोघृतिः" is unusual and its exact intended sense is not fully certain, but it is transcribed exactly as clearly printed rather than silently emended, per the project's zero-fabrication discipline. Directly corroborated in substance by the page's own Hindi prose commentary ("शेष ५ वर्गों में (प्रत्येक में) आधा आधा बल होता है। इस प्रकार षोडशवर्गीय समस्त (पूर्ण) बल, स्ववर्ग में २०, अधि-मित्र [सम्भवतः अगले शब्दों में विस्तृत]"). English/Hindi meanings by Vedic Hora -- for review. CORRECTION: on checking the immediately following page (PDF p.93, printed page 61, scratchpad/bphs-p93-top.png), the closing Hindi commentary there gives its own explicit numeric summary -- "मित्रवर्ग में १८, मित्र में १५, सम में १०, शत्रु में ७, अधिशत्रु में ५" -- which assigns 18, not 20, to the great-friend's sign. "विंशोघृतिः" is retained as printed rather than emended to match, per the project's zero-fabrication discipline; the discrepancy is disclosed in the translation fields above.

संस्कृत

मित्रे पञ्चदश प्रोक्तं समे दश प्रकीर्तितम् । शत्रौ समाधिशत्रौ च पञ्च विश्वावलं भवेत् ॥ २५ ॥

mitre panchadasha proktan same dasha prakiirtitam | shatrau samaadhishatrau cha pancha vishvaavalan bhavet || 25 ||

अंग्रेज़ी अर्थ

In a friend's [sign] (mitre), fifteen (panchadasha) is declared (proktam); in a neutral's [sign] (same), ten (dasha) is pronounced (prakiirtitam). In an enemy's [sign], or (cha) equally in a greater enemy's [sign] (shatrau sama-adhishatrau), the Vimshopaka strength (vishvaavalam) would be (bhavet) five (pancha). [DISCLOSED DISCREPANCY: the verse's own compound "samaadhishatrau" ("sama" + "adhishatrau") reads most naturally as "the enemy's and, equally, the greater-enemy's [sign]", implying ONE shared value of five for both. However, the very next page's own closing Hindi commentary gives a numeric summary with enemy and greater-enemy as two DIFFERENT values -- "शत्रु में ७, अधिशत्रु में ५" (enemy = 7, greater-enemy = 5) -- not the same figure. This verse's own wording was re-verified at high zoom (scratchpad/bphs-p92-v25-word-superzoom2.png) and unambiguously reads "समाधिशत्रौ", not a form of "सप्त" (seven) that would have reconciled the two; the discrepancy is therefore genuine and is preserved here rather than silently resolved, per the same disclosure-without-forced-resolution technique used at ref 7.17 and ref 7.23.]

हिन्दी अर्थ

मित्र की राशि में (मित्रे), पन्द्रह (पञ्चदश) कहा गया है (प्रोक्तं); सम (तटस्थ) की राशि में (समे), दस (दश) कहा गया है (प्रकीर्तितम्)। शत्रु की राशि में, अथवा (च) समान रूप से परम-शत्रु की राशि में भी (शत्रौ समाधिशत्रौ), विंशोपक बल (विश्वावलं) पाँच (पञ्च) होगा (भवेत्)। [प्रकट की गई विसंगति: श्लोक का अपना समास "समाधिशत्रौ" ("सम" + "अधिशत्रौ") सबसे स्वाभाविक रूप से "शत्रु और, समान रूप से, परम-शत्रु [की राशि]" के रूप में पढ़ा जाता है, जिसका अर्थ है दोनों के लिए एक ही साझा मान पाँच। परन्तु अगले पृष्ठ की अपनी समापन हिन्दी टीका शत्रु और परम-शत्रु को दो भिन्न मान देती है -- "शत्रु में ७, अधिशत्रु में ५" (शत्रु = ७, परम-शत्रु = ५) -- समान आँकड़ा नहीं। इस श्लोक के अपने शब्द को उच्च ज़ूम पर पुनः जाँचा गया (scratchpad/bphs-p92-v25-word-superzoom2.png) और यह निःसंदेह "समाधिशत्रौ" ही पढ़ा जाता है, न कि "सप्त" (सात) का कोई रूप जो दोनों को मेल करा देता; अतः यह विसंगति वास्तविक है और यहाँ इसे चुपचाप सुलझाए बिना संरक्षित रखा गया है, ठीक उसी प्रकार जैसे सन्दर्भ ७.१७ और ७.२३ में किया गया था।]

स्रोत: BPHS Ch.7, verse 25, closing the Shodashavarga (sixteen-varga) topic, Kashi Sanskrit Series No.220, PDF p.92 (printed page 60). Read from the standard 600dpi full-page render and precise zoom crops (scratchpad/bphs-p92-v25l2b-a/b/c.png and bphs-p92-v25l2c-a/b/c.png at 2x), confirming both lines letter-by-letter, including "समाधिशत्रौ" (a single sandhi-joined compound, not printed with a hyphen) with no ambiguity. English/Hindi meanings by Vedic Hora -- for review. CORRECTION: on checking the immediately following page (PDF p.93, printed page 61, scratchpad/bphs-p93-top.png), the closing Hindi commentary gives "शत्रु में ७, अधिशत्रु में ५" -- enemy and greater-enemy as two distinct values, not one shared value as this verse's own compound "समाधिशत्रौ" (re-verified at 4x zoom, scratchpad/bphs-p92-v25-word-superzoom2.png, ruling out a misread of "सप्त") suggests. Disclosed rather than silently resolved in either direction.

संस्कृत

स्फुटविंशोपक-बल-- वर्गविश्वाः स्वविश्वघ्नाः पुनर्विंशतिभाजिताः । विंशोपकं फलार्हं तत्पञ्चोनं फलदं नहि ॥ २६ ॥

sphutavinshopaka-bala -- vargavishvaah svavishvaghnaah punarvinshatibhaajitaah | vinshopakan phalaarhan tatpanchoonan phaladan nahi || 26 ||

अंग्रेज़ी अर्थ

[Heading, printed by the editor:] The Sphuta (exact/refined) Vimshopaka Bala:-- The varga-strengths [i.e. each planet's own condition-based score, out of twenty, within a given varga] (vargavishvaah), multiplied by their own [varga's] weight-unit (svavishva-ghnaah), [and] again (punah) divided by twenty (vinshati-bhaajitaah) -- [this gives] the exact Vimshopaka [score]. [When full, i.e. twenty,] the Vimshopaka (vinshopakam) is deserving of fruit (phala-arham); that (tat) diminished by five [i.e. anything below five] (pancha-uunam) does not give fruit at all (phaladam nahi).

हिन्दी अर्थ

[संपादक द्वारा मुद्रित शीर्षक:] स्फुटविंशोपक-बल-- वर्ग-बल (अर्थात्, किसी विशेष वर्ग में ग्रह का अपना स्थिति-आधारित बीस में से अंक) (वर्गविश्वाः), अपने [उस वर्ग के] भार-इकाई से गुणा करके (स्ववश्वघ्नाः), [और] पुनः (पुनः) बीस से भाग देने पर (विंशतिभाजिताः) -- [यह] सूक्ष्म (स्फुट) विंशोपक [अंक देता है]। [जब पूर्ण, अर्थात् बीस, हो तब] विंशोपक (विंशोपकं) फल देने योग्य होता है (फलार्हं); उससे (तत्) पाँच घटा हुआ [अर्थात् पाँच से कम कुछ भी] (पञ्चोनं) बिल्कुल फल नहीं देता (फलदं नहि)। [टिप्पणी: "फलार्हं" और "पञ्चोनं" शब्द नीचे स्रोत में बताए गए दृश्य कारणों से सावधानी से पढ़े गए हैं।]

स्रोत: BPHS Ch.7, verse 26, opening the "स्फुटविंशोपक-बल" (Sphuta/exact Vimshopaka Bala) topic under the editor's printed heading, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.93 (printed page 61). Read from a fresh 600dpi full-page render (scratchpad/bphs-p93-600.png) and zoom crops (scratchpad/bphs-p93-v26l2-full.png at 2x for the full line; scratchpad/bphs-p93-panchona-zoom3.png at 2.5x for the disputed conjunct). TWO WORDS CARRY DISCLOSED VISUAL AMBIGUITY, resolved here by grammar/context rather than shape alone, per the project's disclosure discipline: (1) "फलार्हं" (phalaarham, "fruit-deserving") -- the reph-plus-ह ligature at small size could superficially resemble a separate "ई" vowel-sign, which would spell a meaningless "फलाई"; "फलार्हं" is adopted as the only grammatically sound reading of the shape, agreeing with the neuter "विंशोपकं". (2) "पञ्चोनं" (panchoonam, "diminished by five") -- the conjunct under the प in the zoomed crop could be misread as "श्च" (giving the ungrammatical "पश्चोनं", since "पश्च" is not an attested standalone Sanskrit word) rather than "ञ्च" (giving "पञ्चोनं", the expected sandhi form of पञ्च + ऊनम्, "five" + "diminished"); "पञ्चोनं" is adopted because it is grammatically valid AND directly coheres with the explicit grading scale given in the very next verse (7.27: above five = slight fruit, above ten = medium, above fifteen = full), implying anything below five gives none. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तदूर्ध्वं स्वल्पफलदं दशोर्ध्वं मध्यमं स्मृतम् । तिथ्यूर्ध्वं पूर्णफलदं बोध्यं सर्वं खचारिणाम् ॥ २७ ॥

tadurdhvan svalpaphaladan dashordhvan madhyaman smritam | tithyuurdhvan puurnaphaladan bodhyan sarvan khachaarinaam || 27 ||

अंग्रेज़ी अर्थ

Above that [five] (tat-uurdhvam), it gives slight fruit (svalpa-phaladam); above ten (dasha-uurdhvam), it is remembered (smritam) as medium (madhyamam). Above the tithi-count [fifteen, a bhuta-samkhya numeral-word from the fifteen lunar tithis of a paksha] (tithi-uurdhvam), it gives full fruit (puurna-phaladam) -- this is to be understood (bodhyam) for all (sarvam) the sky-goers [planets] (khachaarinaam) alike.

हिन्दी अर्थ

उससे [पाँच से] ऊपर (तदूर्ध्वं), थोड़ा फल देता है (स्वल्पफलदं); दस से ऊपर (दशोर्ध्वं), मध्यम (मध्यमं) माना गया है (स्मृतम्)। तिथि-संख्या [पन्द्रह, एक पक्ष की पन्द्रह तिथियों से यह भूतसंख्या-पद] (तिथ्यूर्ध्वं) से ऊपर, पूर्ण फल देता है (पूर्णफलदं) -- यह सभी (सर्वं) आकाशचारी ग्रहों (खचारिणाम्) के लिए समान रूप से समझना चाहिए (बोध्यं)।

स्रोत: BPHS Ch.7, verse 27, closing the Sphuta Vimshopaka Bala grading-scale topic, Kashi Sanskrit Series No.220, PDF p.93 (printed page 61). Read from the standard 600dpi full-page render and the overview zoom crop (scratchpad/bphs-p93-top.png at 1.2x), legible cleanly with no ambiguity. The bhuta-samkhya decoding of "tithi" as fifteen is standard (a lunar paksha has fifteen tithis) and directly explains why this is the threshold for full fruit, paralleling the "vedaah"=4 and "raatrinaayakah"=1 encodings used earlier on this page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

उदयास्तविंशोपक-- अथान्यदपि वक्ष्यामि मैत्रेय ! त्वं विधारय । खेटाः पूर्णं फलं दद्युः सूर्यात्समके स्थिताः ॥ २८ ॥

udayaastavinshopaka -- athaanyadapi vakshyaami maitreya ! tvan vidhaaraya | khetaah puurnan phalan dadyuh suuryaat samake sthitaah || 28 ||

अंग्रेज़ी अर्थ

[Heading, printed by the editor:] The Udayasta (rising-setting) Vimshopaka:-- Now (atha) I shall declare (vakshyaami) something else (anyat api) too, O Maitreya (maitreya)! Retain it (tvam vidhaaraya). The planets (khetaah), when situated (sthitaah) at the "equal" point from the Sun (suuryaat samake) -- [clarified by the page's own Hindi commentary as the seventh house from the Sun, i.e. solar opposition] -- give (dadyuh) full (puurnam) fruit (phalam).

हिन्दी अर्थ

[संपादक द्वारा मुद्रित शीर्षक:] उदयास्तविंशोपक-- अब (अथ) मैं और कुछ (अन्यत् अपि) भी कहूँगा (वक्ष्यामि), हे मैत्रेय (मैत्रेय)! इसे धारण करो (त्वं विधारय)। ग्रह (खेटाः), सूर्य से "सम" स्थान में (सूर्यात्समके) स्थित होने पर (स्थिताः) -- [पृष्ठ की अपनी हिन्दी टीका द्वारा स्पष्ट किया गया कि यह सूर्य से सातवाँ स्थान है, अर्थात् सूर्य से प्रतियोग (opposition)] -- पूर्ण (पूर्णं) फल (फलं) देते हैं (दद्युः)।

स्रोत: BPHS Ch.7, verse 28, opening the "उदयास्तविंशोपक" (Udayasta/rising-setting Vimshopaka) topic under the editor's printed heading, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.93 (printed page 61). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p93-udayasta1-left.png/-right.png, scratchpad/bphs-p93-v28l2f-left.png/-right.png at 1.5-1.6x), legible with no ambiguity in the letters themselves. The verse's own compressed phrase "सूर्यात्समके" ("at the equal [point] from the Sun") is directly clarified by the page's own Hindi prose commentary immediately below ("सूर्य से सप्तम स्थान में स्थित ग्रह पूर्ण फल देता है" -- "a planet situated in the seventh place from the Sun gives full fruit"), read from scratchpad/bphs-p93-after28.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

फलाभावं विजानीयात् समे सूर्यनभश्चरे । मध्येऽनुपातात् सर्वत्र ह्युदयास्त-विंशोपकाः ॥ २९ ॥

phalaabhaavan vijaaniiyaat same suuryanabhashchare | madhye'nupaataat sarvatra hyudayaasta-vinshopakaah || 29 ||

अंग्रेज़ी अर्थ

One should know (vijaaniiyaat) the absence of fruit (phala-abhaavam) when the sky-goer [planet] (nabhashchare) is equal/same [i.e. conjunct] with the Sun (same suurya-). In between (madhye), everywhere (sarvatra), by proportion (anupaataat) indeed (hi) [are] the Udayasta Vimshopakas (udayaasta-vinshopakaah, the rising-setting Vimshopaka values) [to be found].

हिन्दी अर्थ

जब ग्रह (नभश्चरे) सूर्य के समान/तुल्य [अर्थात् युति में] हो (समे सूर्य-), तब फल का अभाव (फलाभावं) जानना चाहिए (विजानीयात्)। मध्य में (मध्ये), सर्वत्र (सर्वत्र), अनुपात से (अनुपातात्) ही (हि) उदयास्त-विंशोपक (उदयास्त-विंशोपकाः, अर्थात् उदय-अस्त संबंधी विंशोपक मान) [जानने चाहिए]।

स्रोत: BPHS Ch.7, verse 29, completing the opening statement of the Udayasta Vimshopaka scale (full at the seventh/opposition per verse 28, zero at conjunction, proportional in between), Kashi Sanskrit Series No.220, PDF p.93 (printed page 61). Read from the standard 600dpi full-page render and overview zoom crop (scratchpad/bphs-p93-after28.png at 1.28x), legible cleanly with no ambiguity. Directly and fully corroborated by the page's own Hindi prose commentary immediately below ("सूर्य के समान ग्रह निष्फल हुआ करता है। मध्य (सूर्य तथा उससे सप्तम के बीच) में विद्यमान ग्रह आनुपातिक फल देता है"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वर्गविश्वावलं ज्ञेयं फलमस्य द्विजर्षभ ! । यच्च यत्र फलं बुद्ध्वा तत्फलं परिकीर्तितम् ॥ ३० ॥

vargavishvaavalan jneyan phalamasya dvijarshabha ! yachcha yatra phalan buddhvaa tatphalan parikiirtitam || 30 ||

अंग्रेज़ी अर्थ

The varga-strength (varga-vishvaavalam) of this [planet] (asya) should be known (jneyam) [as] its fruit (phalam), O best of the twice-born (dvija-rshabha)! And whatever (yat cha) fruit (phalam) is understood (buddhvaa) in whichever [varga] (yatra), that (tat) is declared (parikiirtitam) [as] its fruit (phalam).

हिन्दी अर्थ

इस [ग्रह] के (अस्य) वर्ग-बल को (वर्गविश्वावलं) ही उसका फल जानना चाहिए (ज्ञेयं फलम्), हे द्विजश्रेष्ठ (द्विजर्षभ)! और (यच्च) जिस-जिस [वर्ग] में (यत्र) जो फल समझ में आए (फलं बुद्ध्वा), वही (तत्) फल कहा गया है (फलं परिकीर्तितम्)।

स्रोत: BPHS Ch.7, verse 30, a general rule opening the concluding portion of the varga-strength discussion, Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.93 (printed page 61). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p93-v30l1-left.png/-right.png, scratchpad/bphs-p93-v30l2-left.png/-right.png at 1.4x), legible cleanly with no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वर्गविश्वावलं चादावुदयास्त मतः परम् । पूर्णं पूर्णेऽतिपूर्णं स्यात् सर्वदैवं विचिन्तयेत् ॥ ३१ ॥

vargavishvaavalan chaadaavudayaasta matah param | puurnan puurne'tipuurnan syaat sarvadaivan vichintayet || 31 ||

अंग्रेज़ी अर्थ

The varga-strength (varga-vishvaavalam), and (cha) first (aadau) the Udayasta [strength] (udayaasta), thereafter (matah param) [being combined] -- when full (puurnam), one should always (sarvadaiva) consider (vichintayet) that it would be (syaat), within the full [category itself], [further divided as] full and very-full (puurne atipuurnam). [The page's own Hindi commentary on the immediately following page (PDF p.94) glosses these four base categories -- full/very-full, medium/very-medium, low/very-low, scanty/very-scanty -- with specific Vimshopaka-point ranges: full 15 to 17.5 and 17.5 to 20; not transcribed here as verse content, only as corroborating context, since it belongs to the editor's prose, not the root verse.]

हिन्दी अर्थ

वर्ग-बल (वर्गविश्वावलं), और (च) पहले (आदौ) उदयास्त [बल] (उदयास्त), फिर (मतः परम्) [दोनों को मिलाकर] -- पूर्ण (पूर्णं) होने पर, सदैव (सर्वदैव) यह विचार करना चाहिए (विचिन्तयेत्) कि वह पूर्ण [वर्ग] में भी (पूर्णेऽति) पूर्ण और अतिपूर्ण (पूर्णेऽतिपूर्णं) होगा (स्यात्)। [अगले पृष्ठ (PDF p.94) की अपनी हिन्दी टीका इन चार मूल श्रेणियों -- पूर्ण/अतिपूर्ण, मध्य/अतिमध्य, हीन/अतिहीन, स्वल्प/अत्यल्प -- को विशिष्ट विंशोपक-अंक-सीमाएँ देकर स्पष्ट करती है: पूर्ण में १५ से १७.५, तथा १७.५ से २०; यह यहाँ श्लोक-सामग्री के रूप में नहीं, केवल संपादक की गद्य-टीका के सन्दर्भ हेतु उल्लिखित है।]

स्रोत: BPHS Ch.7, verse 31, opening the fourfold (each further twofold) grading scale for the combined varga-plus-Udayasta Vimshopaka total, Kashi Sanskrit Series No.220, PDF p.93 (printed page 61), continuing onto the editor's prose on PDF p.94 (printed page 62). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p93-v31l1-right.png, scratchpad/bphs-p93-v32b-left.png/-right.png at 1.5x), legible cleanly with no ambiguity in the verse's own letters. The specific degree-thresholds for each subcategory (e.g. full=15-17.5, very-full=17.5-20) come only from the editor's Hindi prose commentary on the next page (scratchpad/bphs-p94-svarupa-left.png/-right.png, scratchpad/bphs-p94-svarupa2-left.png), read silently as corroborating context per the project's copyright-safety discipline, and are not themselves part of the Sanskrit root verse. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

हीनं हीनेऽतिहीनं स्यात् स्वल्पेऽल्पात्यल्पकं स्मृतम् । मध्यं मध्येऽतिमध्यं स्याद् यावदस्य दशास्थितिः ॥ ३२ ॥

hiinan hiine'tihiinan syaat svalpe'lpaatyalpakan smritam | madhyan madhye'timadhyan syaad yaavadasya dashaasthitih || 32 ||

अंग्रेज़ी अर्थ

Low (hiinam) would be (syaat), within the low [category itself], low and very-low (hiine atihiinam). In the scanty [category] (svalpe), it is remembered (smritam) as scanty and very-scanty (alpa-atyalpakam). Medium (madhyam) would be (syaat), within the medium [category itself], medium and very-medium (madhye atimadhyam) -- for as long as (yaavat) that [planet's] (asya) dasha's own duration/state lasts (dashaa-sthitih) [this fourfold-cum-eightfold grading applies to its fruit].

हिन्दी अर्थ

हीन (हीनं) होगा (स्यात्), हीन [श्रेणी] में भी हीन और अतिहीन (हीनेऽतिहीनं)। स्वल्प [श्रेणी] में (स्वल्पे), अल्प और अत्यल्पक (अल्पात्यल्पकं) कहा गया है (स्मृतम्)। मध्य (मध्यं) होगा (स्याद्), मध्य [श्रेणी] में भी मध्य और अतिमध्य (मध्येऽतिमध्यं) -- जब तक (यावत्) उस [ग्रह] की (अस्य) दशा की स्थिति (दशास्थितिः) रहे [तब तक यह वर्गीकरण उसके फल पर लागू होता है]।

स्रोत: BPHS Ch.7, verse 32, completing the fourfold grading scale (full/very-full at 7.31; low/very-low, scanty/very-scanty, medium/very-medium here), and closing the topic. Each of verses 30, 31, and 32 carries its own individual printed verse-number (३०, ३१, ३२) after its own couplet, confirmed at scratchpad/bphs-p93-bottom.png; the joint marker "॥ ३०-३२ ॥" appears only once, later, in the editor's Hindi prose commentary on the following page (PDF p.94), summarizing the whole scheme. Kashi Sanskrit Series No.220, PDF p.93 (printed page 61). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p93-v32c-left.png/-right.png, scratchpad/bphs-p93-v32d-left.png/-right.png at 1.4x). The final compound "dashaasthitih" was re-verified at 3.5x zoom (scratchpad/bphs-p93-sthiti-superzoom.png) against the tightly-kerned small print; "स्थितिः" (sthitih, "duration/state", from the verb-root स्था) is adopted as the only lexically valid reading cohering with "यावत्" ("for as long as"), since no alternative parse yields an attested Sanskrit word. The category name "svalpa" (verse's own word) is glossed by the next page's Hindi commentary using the same term (confirmed at scratchpad/bphs-p94-svarupa2-left.png, ruling out an initial low-resolution misreading of that commentary word as "svaruupa"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

केन्द्रादि-संज्ञा-- अथान्यदपि वक्ष्यामि मैत्रेय ! शृणु सुव्रत । लग्नतुर्यास्तवियतां केन्द्रसंज्ञा विशेषतः ॥ ३३ ॥

kendraadi-sanjnaa -- athaanyadapi vakshyaami maitreya ! shrinu suvrata | lagnaturyaastaviyataan kendrasanjnaa visheshatah || 33 ||

अंग्रेज़ी अर्थ

[Heading, printed by the editor:] The Kendraadi (angular-etc.) nomenclature:-- Now (atha) I shall declare (vakshyaami) something else (anyat api) too, O Maitreya (maitreya)! Listen (shrinu), O one of good vows (suvrata). Of the Lagna, 4th, 7th, and 10th (lagna-turya-asta-viyataam) [houses], the designation "Kendra" (kendra-samjnaa) [applies] specially/particularly (visheshatah).

हिन्दी अर्थ

[संपादक द्वारा मुद्रित शीर्षक:] केन्द्रादि-संज्ञा-- अब (अथ) मैं और कुछ (अन्यत् अपि) भी कहूँगा (वक्ष्यामि), हे मैत्रेय (मैत्रेय)! सुनो (शृणु), हे सुव्रत (सुव्रत)। लग्न, चतुर्थ, सप्तम और दशम (लग्नतुर्यास्तवियतां) [भावों] की, विशेष रूप से (विशेषतः) "केन्द्र" संज्ञा (केन्द्रसंज्ञा) है।

स्रोत: BPHS Ch.7, verse 33, opening a new topic under the editor's printed heading "केन्द्रादि-संज्ञा--" (Kendraadi-samjna, house-classification nomenclature), immediately following the fourfold Vimshopaka grading scale (verses 30-32). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.94 (printed page 62). Read from the standard 600dpi full-page render (scratchpad/bphs-p94-600.png) and split zoom crops (scratchpad/bphs-p94-v33l1-left.png/-right.png, scratchpad/bphs-p94-v33l2-left.png/-right.png at 1.5x), legible cleanly with no ambiguity. "विषतां"/"वियतां" (viyataam, genitive plural of the compound listing Lagna/4th/7th/10th) and "विशेषतः" both confirmed clean at this zoom. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्विपञ्चरन्ध्रलाभानां ज्ञेया परफणाभिधा । त्रिषड्भाग्यव्ययानां स्यादापोक्लिममिति द्विज ॥ ३४ ॥

dvipanchara(ndhra)laabhaanaan jneyaa paraphanaabhidhaa | trishadbhaagyavyayaanaan syaadaapoklimamiti dvija || 34 ||

अंग्रेज़ी अर्थ

Of the 2nd and 5th (dvi-pancha), the 8th (randhra), and the 11th (laabha) [houses], the designation "Paraphana" [Panaphara, succedent] (paraphana-abhidhaa) should be known (jneyaa). Of the 3rd, 6th (tri-shad), 9th (bhaagya), and 12th (vyaya) [houses], it would be (syaat) [called] "Apoklima" (aapoklimam), thus (iti), O twice-born (dvija).

हिन्दी अर्थ

द्वितीय और पंचम (द्विपञ्च), अष्टम (रन्ध्र), तथा एकादश (लाभ) [भावों] की "परफणा" [पणफर, अर्थात् द्वितीय/पंचम/अष्टम/एकादश स्थान] संज्ञा (परफणाभिधा) जाननी चाहिए (ज्ञेया)। तृतीय, षष्ठ (त्रिषड्), नवम (भाग्य), और द्वादश (व्यय) [भावों] की, हे द्विज (द्विज), "आपोक्लिम" (आपोक्लिमम्) इस प्रकार (इति) संज्ञा होगी (स्यात्)।

स्रोत: BPHS Ch.7, verse 34, defining Panaphara (succedent houses 2,5,8,11) and Apoklima (cadent houses 3,6,9,12). Kashi Sanskrit Series No.220, PDF p.94 (printed page 62). Read from split zoom crops (scratchpad/bphs-p94-v34l1-left.png/-right.png, scratchpad/bphs-p94-v34l2b-left.png/-right.png at 1.5x). DISCLOSED VISUAL AMBIGUITY: the opening conjunct of line 1 was zoomed to 3x (scratchpad/bphs-p94-dvipancha-zoom2.png) and remains genuinely ambiguous between a reading of "द्विपञ्च" (dvi-pancha, "2 and 5") and a superficially similar "द्विपश्च" -- the latter is not an attested Sanskrit word/compound in this context. "द्विपञ्च" is adopted on grammatical and semantic necessity: the compound must denote the 2nd and 5th houses (jointly with रन्ध्र=8th and लाभ=11th) to match the canonical Panaphara/succedent-house set {2,5,8,11}, exactly paralleling the disclosure-without-forced-resolution technique already applied at ref 7.26 ("पञ्चोनं"/"पश्चोनं"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नात् पञ्चमभाग्यस्य कोणसंज्ञा विधीयते । षष्ठाष्टव्ययभावास्तु दुःसंज्ञास्त्रिकसंज्ञकाः ॥ ३५ ॥

lagnaat panchamabhaagyasya koonasanjnaa vidhiiyate | shashthaashtavyayabhaavaastu duhsanjnaastrikasanjnakaah || 35 ||

अंग्रेज़ी अर्थ

Of the Lagna, 5th, and Bhaagya [9th] (lagnaat panchama-bhaagyasya), the designation "Kona" (kona-samjnaa) is ordained (vidhiiyate). The 6th, 8th, and 12th houses (shashtha-ashta-vyaya-bhaavaah), however (tu), [bear] the "Duh" designation (duh-samjnaah) [and] are called (samjnakaah) "Trika" (trika-).

हिन्दी अर्थ

लग्न, पंचम, और भाग्य [नवम] (लग्नात् पञ्चमभाग्यस्य) की "कोण" संज्ञा (कोणसंज्ञा) विहित है (विधीयते)। षष्ठ, अष्टम, और द्वादश (व्यय) भाव (षष्ठाष्टव्ययभावाः), किन्तु (तु), "दुः" संज्ञा वाले (दुःसंज्ञाः) [और] "त्रिक" कहलाते हैं (त्रिकसंज्ञकाः)।

स्रोत: BPHS Ch.7, verse 35, defining Kona (trine houses -- Lagna, 5th, 9th) and Duhsamjna/Trika (inauspicious houses 6,8,12). Kashi Sanskrit Series No.220, PDF p.94 (printed page 62). Line 1 read from scratchpad/bphs-p94-v35l1-left.png/-right.png at 1.5x, clean with no ambiguity. Line 2's opening word "दुःसंज्ञा" was initially uncertain at 1.5x and was re-verified with a targeted 2.5x zoom (scratchpad/bphs-p94-duhsanjna-zoom2.png), which clearly shows the visarga (two dots) after द, confirming "दुःसंज्ञा" (not an alternative reading), continuing into त्रि(कसंज्ञकाः). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुरस्रं तुर्यरन्ध्रं कथयन्ति द्विजोत्तम । स्वस्थादुपचयक्षोणि त्रिषडायाम्बराणि हि ॥ ३६ ॥

chaturasran turyarandhran kathayanti dvijottama | svasthaadupachayakshooni trishadaayaambaraani hi || 36 ||

अंग्रेज़ी अर्थ

The 4th and 8th (turya-randhram) they call (kathayanti) "Chatursra" (chatur-asram), O best of the twice-born (dvija-uttama). From one's own [Lagna] (svasthaat), the Upachaya [growth-houses] (upachaya-...) -- the 3rd, 6th (tri-shad), 11th (aaya), and "ambara" [sky, i.e. the 10th] (ambaraani) -- indeed (hi) [bear this designation].

हिन्दी अर्थ

चतुर्थ और अष्टम (तुर्यरन्ध्रं) को "चतुरस्र" (चतुरस्रं) कहते हैं (कथयन्ति), हे द्विजोत्तम (द्विजोत्तम)। अपने [लग्न] से (स्वस्थात्), उपचय [वृद्धि-स्थान] -- तृतीय, षष्ठ (त्रिषड्), एकादश (आय), और "अम्बर" [आकाश, अर्थात् दशम] (अम्बराणि) -- ही (हि) [इस संज्ञा को धारण करते हैं]।

स्रोत: BPHS Ch.7, verse 36, defining Chatursra (4th/8th houses) and Upachaya (growth houses: 3rd, 6th, 10th via the poetic term "ambara"/sky, and 11th), closing the Kendraadi-samjna topic (verses 33-36). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.94 (printed page 62). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p94-v36-full.png at 1.5x for line 1; scratchpad/bphs-p94-v36l2-left-zoom.png/-right-zoom.png at 2.2x for line 2). DISCLOSED UNUSUAL SPELLING: the compound printed in line 2 reads, letter-for-letter at 3.5x targeted zoom (scratchpad/bphs-p94-upachaya-superzoom.png), as "...उपचयक्षोणि" (upachaya-kshoni) rather than a more expected form such as "upachayaakhyaani" ("called Upachaya") -- the glyphs य-क्ष-ो-णि are unambiguous at this zoom, so this unusual reading is preserved exactly as printed per the zero-fabrication discipline, rather than silently emended to a more conventional-sounding compound; its precise grammatical derivation is left uncertain, paralleling the same treatment given to "विंशोघृतिः" at ref 7.24. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तन्वादिभाव-- तनुधनं च सहजो बन्धुपुत्रारयस्तथा । युवतीरन्ध्र धर्माख्य-कर्मलाभव्ययाः क्रमात् ॥ ३७ ॥

tanvaadibhaava -- tanudhanan cha sahajo bandhuputraarayastathaa | yuvatirandhra dharmaakhya-karmalaabhavyayaah kramaat || 37 ||

अंग्रेज़ी अर्थ

[Heading, printed by the editor:] The Tanvaadi ("beginning with the body") houses:-- Tanu [the body/1st] and (cha) Dhana [wealth/2nd] (tanu-dhanam), and Sahaja [co-born/3rd] (sahajah), Bandhu [kin/4th], Putra [children/5th], and Ari [enemy/6th] (arayah) likewise (tathaa); Yuvati [wife/7th], Randhra [the aperture/8th], the one named Dharma [9th] (dharma-aakhya), Karma [action/10th], Laabha [gain/11th], and Vyaya [loss/12th] -- in order/respectively (kramaat) [these are the twelve houses' synonym-names].

हिन्दी अर्थ

[संपादक द्वारा मुद्रित शीर्षक:] तन्वादिभाव-- तनु [शरीर/प्रथम] और (च) धन [द्वितीय] (तनुधनं), तथा सहज [सहोदर/तृतीय] (सहजो), बन्धु [चतुर्थ], पुत्र [पंचम], और अरि [शत्रु/षष्ठ] (अरयः) उसी प्रकार (तथा); युवती [पत्नी/सप्तम], रन्ध्र [अष्टम], धर्म नामक [नवम] (धर्माख्य), कर्म [दशम], लाभ [एकादश], और व्यय [द्वादश] -- क्रमशः (क्रमात्) [ये बारह भावों के पर्यायवाची नाम हैं]।

स्रोत: BPHS Ch.7, verse 37, opening a new topic under the editor's printed heading "तन्वादिभाव--" (Tanvaadi-bhaava, the twelve houses' poetic synonym-names), immediately following the closing commentary on the Kendraadi-samjna topic (verses 33-36, confirmed via that commentary's own summary "॥ ३३-३६ ॥" naming Kendra=1,4,7,10, Panaphara=2,5,8,11, Apoklima=3,6,9,12, Kona=lagna,5,9, Duhsamjna/Trika=6,8,12 -- all matching this project's transcriptions). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.94 (printed page 62). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p94-v37l1-left.png/-right.png, scratchpad/bphs-p94-v37l2-left.png/-right.png at 2x; scratchpad/bphs-p94-sahajo-zoom2.png at 3.5x for "सहजो"; scratchpad/bphs-p94-v37num-zoom3.png at 3.5x confirming the closing verse-number "३७"). The list gives the twelve traditional Sanskrit house-synonyms in strict order (1st through 12th), a standard and internally self-consistent enumeration with no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

संक्षेपेणैतदुदित-मन्यद् बुद्ध्यनुसारतः । किंचिद्विशेषं वक्ष्यामि यथा ब्रह्ममुखाच्छ्रुतम् ॥ ३८ ॥

sankshepenaitadudita-manyad buddhyanusaaratah | kinchidvisheshan vakshyaami yathaa brahmamukhaachchhrutam || 38 ||

अंग्रेज़ी अर्थ

This (etat) has been briefly (sankshepena) declared (udita-), [to be] considered/understood (manyat) according to [one's own] understanding (buddhi-anusaaratah). [Now] I shall declare (vakshyaami) something (kinchit) special (vishesham), just as (yathaa) it was heard (shrutam) from Brahma's own mouth (brahma-mukhaat).

हिन्दी अर्थ

यह (एतत्) संक्षेप में (संक्षेपेण) कहा गया है (उदितं), [अपनी] बुद्धि के अनुसार (बुद्ध्यनुसारतः) समझा जाने योग्य (मन्यत्)। [अब] मैं कुछ (किंचित्) विशेष (विशेषं) कहूँगा (वक्ष्यामि), जैसा (यथा) कि ब्रह्मा के मुख से (ब्रह्ममुखात्) सुना गया (श्रुतम्)।

स्रोत: BPHS Ch.7, verse 38, closing the Tanvaadi-bhaava topic (verses 37-38) and transitioning to a new topic "heard from Brahma's own mouth", confirmed by the editor's own closing Hindi commentary on this page which paraphrases both verses together ("तनु धन सहज बन्धु पुत्र अरि जाया रन्ध्र धर्म कर्म लाभ व्यय ये लग्नादि द्वादश भाव हैं...अब मैं ब्रह्मा के मुख से सुनी हुई विशेष बात बताऊंगा") under the joint marker "॥ ३७-३८ ॥". Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.94 (printed page 62). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p94-v38l1-left.png/-right.png, scratchpad/bphs-p94-v38l2-left.png/-right.png at 2x). DISCLOSED UNUSUAL COMPOUND: line 1's phrase "एतदुदित-मन्यद्" (printed with the editor's own hyphen marking a compound break) is grammatically atypical -- "मन्यद्" (for expected "मन्यत्", a present participle "to be thought/considered") is transcribed exactly as printed rather than silently normalized to a more standard form, per the zero-fabrication discipline; the overall sense ("this has been briefly stated according to [the author's] own understanding") is clear from context and corroborated by the page's own Hindi commentary, even though the precise word-by-word grammar of this specific compound is left disclosed rather than forced into a fully regularized parse. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नवमेऽपि पितुर्ज्ञानं सूर्याच्च नवमेऽथवा । यत्किंचिद्दशमे लाभे तत्सूर्याद्दशमे शिवे ॥ ३९ ॥

navame'pi piturjnaanan suuryaachcha navame'thavaa | yatkinchiddashame laabhe tatsuuryaaddashame shive || 39 ||

अंग्रेज़ी अर्थ

In the 9th [house from Lagna] (navame api), also (api), [is seen] the father's (pituh) knowledge (jnaanam); or (athavaa), likewise (cha), from the Sun's own 9th (suuryaat navame). Whatever (yat kinchit) [pertains] in the 10th (dashame) [regarding] gain (laabhe), that (tat) too [is considered] from the Sun's 10th (suuryaat dashame), O auspicious one (shive).

हिन्दी अर्थ

नवम [भाव] में (नवमेऽपि) भी, पिता का (पितुः) ज्ञान (ज्ञानं) [देखा जाता है]; या (अथवा) उसी प्रकार (च) सूर्य के नवम भाव से भी (सूर्याच्च नवमे)। दशम [भाव] में (दशमे) लाभ (लाभे) से सम्बन्धित जो कुछ भी (यत्किंचित्), वह (तत्) भी सूर्य के दशम भाव से (सूर्याद्दशमे), हे शिवे (शिवे) [विचारणीय है]।

स्रोत: BPHS Ch.7, verse 39, opening a new topic (multi-reference-point house-signification analysis) immediately following the Tanvaadi-bhaava close (verses 37-38), under the running page-header "वर्गविवेचनाध्यायः" (confirmed via verse-numbering continuity to be Chapter 7's own reprinted running title, not a new chapter). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.95 (printed page 63). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p95-v39l1-left.png/-right.png, scratchpad/bphs-p95-v39l2-left.png/-right.png at 1.8x), legible cleanly with no ambiguity; the closing verse-number "॥ ३९ ॥" is clearly visible in the line-2 right crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तुर्ये तनौ धने लाभे भाग्ये यच्चिन्तनं च तत् । चन्द्रात्तुर्ये तनौ लाभे भाग्ये तच्चिन्तयेद्ध्रुवम् ॥ ४० ॥

turye tanau dhane laabhe bhaagye yachchintanan cha tat | chandraatturye tanau laabhe bhaagye tachchintayeddhruvam || 40 ||

अंग्रेज़ी अर्थ

In the 4th (turye), the body [1st] (tanau), wealth [2nd] (dhane), gain [11th] (laabhe), [and] fortune [9th] (bhaagye) -- whatever (yat) is to be considered (chintanam), that (tat) too (cha) [applies]. From the Moon's own (chandraat) 4th, body [1st], gain [11th], [and] fortune [9th] (turye tanau laabhe bhaagye), that (tat) should certainly (dhruvam) be considered (chintayet) [likewise].

हिन्दी अर्थ

चतुर्थ (तुर्ये), तनु [प्रथम] (तनौ), धन [द्वितीय] (धने), लाभ [एकादश] (लाभे), [और] भाग्य [नवम] (भाग्ये) में जो कुछ भी विचारणीय है (यच्चिन्तनं च तत्), [वह लागू होता है]। चन्द्रमा के अपने (चन्द्रात्) चतुर्थ, तनु [प्रथम], लाभ [एकादश], [और] भाग्य [नवम] भाव से (तुर्ये तनौ लाभे भाग्ये), वह निश्चित रूप से (ध्रुवम्) विचारणीय है (तच्चिन्तयेत्)।

स्रोत: BPHS Ch.7, verse 40, continuing the multi-reference-point topic from the Moon's own vantage point. Kashi Sanskrit Series No.220, PDF p.95 (printed page 63). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p95-v40l1-left.png/-right.png, scratchpad/bphs-p95-v40l2-left.png/-right.png at 1.8x); the closing verse-number "॥ ४० ॥" is clearly visible in the line-2 right crop. NOTE ON CONTENT: zoom confirmed that line 1 lists five houses (4th, 1st, 2nd, 11th, 9th from Lagna) via "तुर्ये तनौ धने लाभे भाग्ये", while line 2's parallel list from the Moon's own reference omits the 2nd house ("धने"), reading only "चन्द्रात्तुर्ये तनौ लाभे भाग्ये" (4th, 1st, 11th, 9th) -- this asymmetry is transcribed exactly as printed rather than silently harmonized to match line 1's five-house list, per the zero-fabrication discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नाद् द्वाश्रिक्यभवने यत्कुजाद् विक्रमेऽखिलम् । विचार्यं षष्ठभावस्य बुधात् पृष्ठे विलोक्येत् ॥ ४१ ॥

lagnaad dvaashrikyabhavane yatkujaad vikrame'khilam | vichaaryan shashthabhaavasya budhaat prishthe vilokyet || 41 ||

अंग्रेज़ी अर्थ

Whatever (yat), entirely (akhilam), [is seen] from Mars's own (kujaat) Vikrama [valor, 3rd house] (vikrame) is to be considered (vichaaryam) [likewise] from Lagna's [corresponding] house (lagnaat ...bhavane). Of the 6th house (shashtha-bhaavasya), [its significations] should be seen (vilokyet) from Mercury's own (budhaat) [corresponding] house.

हिन्दी अर्थ

मंगल के अपने (कुजात्) विक्रम [पराक्रम, तृतीय भाव] (विक्रमे) से जो कुछ भी (यत्), सम्पूर्ण रूप से (अखिलम्), [देखा जाता है], वही लग्न के [सम्बन्धित] भाव से भी (लग्नाद् ...भवने) विचारणीय है (विचार्यं)। षष्ठ भाव (षष्ठभावस्य) [के फलों] को बुध के अपने (बुधात्) [सम्बन्धित] भाव से देखा जाना चाहिए (विलोक्येत्)।

स्रोत: BPHS Ch.7, verse 41, continuing the multi-reference-point topic (verses 39-40: Sun, Moon) with Mars's own Vikrama/3rd house, and introducing Mercury's own reference point for the 6th house. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.95 (printed page 63). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p95-v41l1-left.png/-right.png, scratchpad/bphs-p95-v41l2-left.png/-right.png at 1.8x), with additional targeted 3-4.5x superzoom passes on line 1's second word (scratchpad/bphs-p95-v41word-superzoom2.png, -superzoom3.png). DISCLOSED UNCERTAIN COMPOUND: line 1's second word is transcribed exactly as it appears at maximum confirmed zoom -- "द्वाश्रिक्य" -- which is not a standard dictionary compound; given the parallel with "विक्रमे" (3rd house, from Mars) later in the same line, this word most likely denotes the 3rd house's name as seen from Lagna (compare the Sahaja/3rd synonym established at ref 7.37), but the precise letters do not clearly resolve to "सहज" or any other standard alternative at the zoom levels available, so the printed reading is preserved rather than silently emended. Line 2's word "पृष्ठे" (read as printed, literally "on/at the back") is likewise transcribed as seen rather than forced into an alternative such as "अष्टमे" (8th), since the retroflex vowel-mark is not fully unambiguous at this resolution. English/Hindi meanings by Vedic Hora -- for review, with the overall sense (each house's significations may also be judged from the corresponding planet's own house) clear despite these two unresolved specific words.

संस्कृत

तनयस्य गुरोः पुत्रे जायायाः शुक्रात् सप्तमे तथा । अष्टमस्य व्ययस्यापि मन्दान्मृत्यौ व्यये तथा ॥ ४२ ॥

tanayasya guroh putre jaayaayaah shukraat saptame tathaa | ashtamasya vyayasyaapi mandaanmrityau vyaye tathaa || 42 ||

अंग्रेज़ी अर्थ

Of the son (tanayasya), [his matters are seen] from Jupiter's own (guroh) Putra [5th house] (putre); of the wife (jaayaayaah), likewise (tathaa), from Venus's own (shukraat) 7th (saptame). Of the 8th and also the 12th (ashtamasya vyayasya api), likewise (tathaa), from Saturn's own (mandaat) Mrityu [8th, death] [and] Vyaya [12th, loss] [houses].

हिन्दी अर्थ

पुत्र (तनयस्य) [के विषय] गुरु के अपने (गुरोः) पुत्र [पंचम भाव] से (पुत्रे) [देखे जाते हैं]; पत्नी (जायायाः) [के विषय] भी उसी प्रकार (तथा) शुक्र के अपने (शुक्रात्) सप्तम भाव से (सप्तमे)। अष्टम और द्वादश भाव (अष्टमस्य व्ययस्यापि) [के विषय] भी उसी प्रकार (तथा) शनि के अपने (मन्दात्) मृत्यु [अष्टम] और व्यय [द्वादश] भाव से।

स्रोत: BPHS Ch.7, verse 42, continuing the multi-reference-point topic (verses 39-41: Sun, Moon, Mars, Mercury) with Jupiter's own reference point for son (5th/Putra), Venus's own reference point for wife (7th), then Saturn's own reference point for the 8th (Mrityu) and 12th (Vyaya) houses. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.95 (printed page 63). CORRECTION: an earlier pass of this verse (commit 761f989) misread line 1 as omitting a second planet name, forcing "तथा" to extend Jupiter's own-house technique to the 7th as well. A targeted 2.5x zoom re-check (scratchpad/bphs-p95-v42l1-mid-superzoom.png), prompted by the editor's own Hindi commentary on this page explicitly stating "स्त्री का शुक्र से सप्तम भाव" (the wife's matter, from Venus's own 7th house), revealed the previously-missed word "शुक्रात्" (from Venus) between "जायायाः" and "सप्तमे", now confirmed unambiguous and corrected here. Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p95-v42l1-left.png/-right.png, scratchpad/bphs-p95-v42l2-left.png/-right.png at 1.8x); the closing verse-number "॥ ४२ ॥" is clearly visible in the line-1 right crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यद्भावाद्यत्फलं चिन्त्यं तदीशात्तत्फलं विदुः । ज्ञेयं तस्य फलं तद्धि तत्र चिन्त्यं शुभाशुभम् ॥ ४३ ॥

yadbhaavaadyatphalan chintyan tadiishaattatphalan viduh | jneyan tasya phalan taddhi tatra chintyan shubhaashubham || 43 ||

अंग्रेज़ी अर्थ

Whatever (yat) fruit (phalam) is to be considered (chintyam) from whichever house (yat-bhaavaat), that (tat) same fruit (phalam) is known (viduh) from that [house's own] lord (tad-iishaat) as well. That (tat) fruit (phalam) of it (tasya) should indeed (hi) be known (jneyam); the auspicious or inauspicious [effect] (shubha-ashubham) should be considered (chintyam) there (tatra) [accordingly].

हिन्दी अर्थ

जिस (यत्) भाव से (भावात्) जो (यत्) फल (फलं) विचारणीय है (चिन्त्यं), वही (तत्) फल (फलं) उस [भाव के स्वामी] से भी (तदीशात्) जाना जाता है (विदुः)। उसका (तस्य) वह फल (फलं तत्) निश्चय ही (हि) जानना चाहिए (ज्ञेयं); वहाँ (तत्र) शुभ या अशुभ (शुभाशुभम्) [फल] विचारणीय है (चिन्त्यं)।

स्रोत: BPHS Ch.7, verse 43, closing the multi-reference-point topic (verses 39-42: the seven planets' own-house technique) with a general principle -- that any house's fruit may also be judged from that house's own lord. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.95 (printed page 63). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p95-v43l1b-left.png/-right.png, scratchpad/bphs-p95-v43l2-left.png/-right.png at 1.8x), legible cleanly with no ambiguity; the closing verse-number "॥ ४३ ॥" is clearly visible in the line-2 right crop. Corroborated by the editor's own Hindi prose commentary immediately following on the same page (scratchpad/bphs-p95-after43.png, read silently as context, not transcribed), which illustrates the principle with the example of judging paternal happiness/sorrow from the Lagna or the Sun's own 9th house, and matters of the 10th/11th from Lagna also being examined from the Sun's own 10th/11th. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ दृष्टिभेदवर्णनाध्यायः ॥ ८ ॥ पराशर उवाच-- अथ मेषादिराशीनां द्वादशानां पृथक् पृथक् । दृष्टिभेदं प्रवक्ष्यामि श्रृणु त्वं द्विजसत्तम ॥ १ ॥

atha drishtibhedavarnanaadhyaayah || 8 || paraashara uvaacha-- atha meshaadiraashiinaan dvaadashaanaan prithak prithak | drishtibhedan pravakshyaami shrinu tvan dvijasattama || 1 ||

अंग्रेज़ी अर्थ

Now (atha), the chapter describing the varieties of aspect (Drishtibheda-varnana-adhyaya), Chapter 8. Parashara said -- Now (atha), of the twelve (dvaadashaanaam) signs (raashiinaam) beginning with Mesha [Aries] (meshaadi), separately, one by one (prithak prithak), I shall explain (pravakshyaami) the distinction of aspect (drishtibhedam); listen (shrinu), you (tvam), O best of the twice-born (dvijasattama).

हिन्दी अर्थ

अब (अथ), दृष्टिभेद का वर्णन करने वाला अध्याय (दृष्टिभेदवर्णनाध्यायः), आठवाँ अध्याय (८)। पराशर ने कहा -- अब (अथ) मेष आदि (मेषादि) बारह (द्वादशानां) राशियों (राशीनां) का अलग-अलग, एक-एक करके (पृथक् पृथक्) दृष्टिभेद (दृष्टिभेदं) मैं कहूँगा (प्रवक्ष्यामि); हे द्विजश्रेष्ठ (द्विजसत्तम), तुम सुनो (श्रृणु त्वं)।

स्रोत: BPHS Ch.8 opening, immediately following the Chapter 7 colophon ("वर्गविवेचनाध्यायः समाप्तः ॥ ७ ॥") on the same page. New chapter title "अथ दृष्टिभेदवर्णनाध्यायः ॥ ८ ॥" confirmed, followed by the speaker-tag "पराशर उवाच--" and verse 1. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.95 (printed page 64, bottom half). Read from the standard 600dpi full-page render and targeted zoom crops (scratchpad/bphs-p95-v8-check.png, scratchpad/bphs-p95-v8-1l2.png, scratchpad/bphs-p95-v8-1l2-word2.png at 3.5x). DISCLOSED PRINTED FORM: line 2's third word is printed as "श्रृणु" (with an extra र् before the ऋ-matra) rather than the standard dictionary form "शृणु"; this is a common typesetting variant seen in older Sanskrit prints and is transcribed exactly as printed rather than silently normalized. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राशयोऽभिमुखं विप्र ! प्रपश्यन्ति च पार्श्वभे । चरः स्थिरान् यथा पश्येत् स्थिरोऽपिच तथा चरान् ॥ २ ॥

raashayo'bhimukhan vipra ! prapashyanti cha paarshvabhe | charah sthiraan yathaa pashyet sthiro'picha tathaa charaan || 2 ||

अंग्रेज़ी अर्थ

The signs (raashayah), O Brahmin (vipra), see (prapashyanti) [each other] facing (abhimukham) and (cha) at the sides (paarshvabhe). As (yathaa) a movable [sign] (charah) sees (pashyet) the fixed [signs] (sthiraan), so also (tathaa) a fixed [sign] (sthirah api cha) [sees] the movable [signs] (charaan).

हिन्दी अर्थ

हे विप्र (विप्र), राशियाँ (राशयः) आमने-सामने (अभिमुखं) और (च) पार्श्व में (पार्श्वभे) देखती हैं (प्रपश्यन्ति)। जैसे (यथा) चर राशि (चरः) स्थिर राशियों को (स्थिरान्) देखे (पश्येत्), वैसे ही (तथा) स्थिर राशि भी (स्थिरोऽपिच) चर राशियों को (चरान्) [देखती है]।

स्रोत: BPHS Ch.8, verse 2, continuing immediately after verse 1 on the same page. Kashi Sanskrit Series No.220, PDF p.95 (printed page 64). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p95-v8-2l1.png, scratchpad/bphs-p95-v8-2l2.png at 1.8x), with an additional targeted 3x zoom on the word "पार्श्वभे" (scratchpad/bphs-p95-v8-2l1-word.png) confirming it unambiguously as printed. This verse establishes the general principle of mutual aspect between movable (chara) and fixed (sthira) signs, elaborated in the following verses. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अनन्तिकगतानेवं ग्रहास्तत्र गता अपि । द्विस्वभावो द्विभान् किन्तु नात्मानमवळोकते ॥ ३ ॥

anantikagataanevan grahaastatra gataa api | dvisvabhaavo dvibhaan kintu naatmaanamavalokate || 3 ||

अंग्रेज़ी अर्थ

Likewise (evam), planets (grahaah) that have gone (gataah) to non-adjacent [signs] (anantika-gataan), having gone (gataa) there too (tatra api), [aspect one another in the same way as the signs do]. A dual-bodied [sign] (dvisvabhaavah) [aspects] two [other] signs (dvibhaan), but (kintu) does not behold (na avalokate) itself (aatmaanam).

हिन्दी अर्थ

उसी प्रकार (एवं) जो ग्रह (ग्रहाः) निकटवर्ती न होने वाली [राशियों] में (अनन्तिकगतान्) गए हैं (गता अपि), वे भी वहाँ [उसी प्रकार परस्पर देखते हैं]। द्विस्वभाव राशि (द्विस्वभावो) दो [अन्य] राशियों को (द्विभान्) [देखती है], किन्तु (किन्तु) स्वयं को (आत्मानम्) नहीं देखती (नावळोकते)।

स्रोत: BPHS Ch.8, verse 3, continuing immediately after verse 2 -- verses 1-2 on PDF p.95 (printed page 64), verse 3 at the top of PDF p.96 (printed page 65, running header "बृहत्पाराशरहोराशास्त्रम्"). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). Read from a fresh 600dpi full-page render of PDF p.96 and split zoom crops (scratchpad/bphs-p96-v3l1.png, scratchpad/bphs-p96-v3l2b.png at 1.8x), with an additional 3x zoom on the closing word (scratchpad/bphs-p96-v3l2-word.png). DISCLOSED PRINTED FORM: the final word is printed with the retroflex letter ळ as "अवळोकते" rather than the standard dictionary spelling "अवलोकते" (with ल); confirmed unambiguous at zoom and transcribed exactly as printed, per the zero-fabrication discipline, rather than silently normalized to the more common spelling. English/Hindi meanings by Vedic Hora -- for review; the precise sense of "अनन्तिकगतान्" (planets gone to non-adjacent/non-neighboring signs) and its connection to verse 2's chara/sthira mutual-aspect rule is tentative and may be clarified by later verses in this chapter.

संस्कृत

निरीक्षन्ते चरस्थास्तु स्थिरस्थान् द्युचरांस्तथा । एवं स्थिरगताश्चापि चरस्थान् नान्तिकस्थिताम् ॥ ४ ॥

niriikshante charasthaastu sthirasthaan dyucharaanstathaa | evan sthiragataashchaapi charasthaan naantikasthitaam || 4 ||

अंग्रेज़ी अर्थ

Planets situated in movable [signs] (charasthaah tu) behold (niriikshante) those situated in fixed [signs] (sthirasthaan), and likewise (tathaa) sky-going [planets, i.e. other planets in general] (dyucharaan). Likewise (evam), planets that have gone to fixed [signs] (sthiragataah cha api) [behold those] in movable [signs] (charasthaan), but not (na) one situated in a non-adjacent [near] position (antikasthitaam).

हिन्दी अर्थ

चर राशियों में स्थित ग्रह (चरस्थास्तु) स्थिर राशियों में स्थित (स्थिरस्थान्) और उसी प्रकार (तथा) आकाशचारी अन्य ग्रहों को (द्युचरान्) देखते हैं (निरीक्षन्ते)। उसी प्रकार (एवं) स्थिर राशियों में गए हुए (स्थिरगताश्चापि) [ग्रह] चर राशियों में स्थित [ग्रहों] को (चरस्थान्) [देखते हैं], परन्तु निकटस्थ (अन्तिकस्थिताम्) [ग्रह] को नहीं (न)।

स्रोत: BPHS Ch.8, verse 4. The commentary block corroborating verses 1-3 closes explicitly with "॥ १-३ ॥" (scratchpad/bphs-p96-scan3.png, read silently as context, not transcribed), confirming verse 4 as a fresh verse rather than a continuation. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.96 (printed page 65). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p96-v4l1b.png, scratchpad/bphs-p96-v4l1.png at 1.8x; the latter file, despite its name, captured line 2). TENTATIVE READING: the precise scope of "नान्तिकस्थिताम्" (not [one] situated in a non-adjacent/near position) mirrors the similarly-phrased "अनन्तिकगतान्" of verse 3, and its exact application (which planets are excluded from mutual aspect) is not yet fully clear from this verse alone; may be clarified by subsequent verses or the surrounding Hindi commentary. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्विस्वभावगताः खेटाः प्रपश्यन्ति द्विभास्थितान् । ग्रहान् समस्तानपि तु नात्मना सह संस्थितान् ॥ ५ ॥

dvisvabhaavagataah khetaah prapashyanti dvibhaasthitaan | grahaan samastaanapi tu naatmanaa saha sansthitaan || 5 ||

अंग्रेज़ी अर्थ

Planets (khetaah) situated in dual-bodied [signs] (dvisvabhaava-gataah) behold (prapashyanti) all (samastaan api) [other] planets (grahaan) situated in dual-bodied [signs] (dvibhaa-sthitaan), but (tu) not (na) one situated together (sansthitaan) with itself (aatmanaa saha) [i.e., not one occupying the same sign as itself].

हिन्दी अर्थ

द्विस्वभाव राशियों में स्थित (द्विस्वभावगताः) ग्रह (खेटाः) द्विस्वभाव राशियों में स्थित (द्विभास्थितान्) समस्त (समस्तानपि) [अन्य] ग्रहों को (ग्रहान्) देखते हैं (प्रपश्यन्ति), परन्तु (तु) स्वयं के साथ (आत्मना सह) स्थित [ग्रह] को नहीं (नात्मना सह संस्थितान्) [अर्थात् अपनी ही राशि में स्थित ग्रह को नहीं]।

स्रोत: BPHS Ch.8, verse 5, continuing immediately after verse 4 -- completing the aspect rules for the three sign-categories (chara/movable in v.2 and v.4, sthira/fixed in v.2 and v.4, dvisvabhava/dual-bodied in v.3 and now v.5). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.96 (printed page 65). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p96-v5l1.png, scratchpad/bphs-p96-v5l2.png at 1.8x), with an additional 3x zoom on line 1's closing compound (scratchpad/bphs-p96-v5l1-word.png) confirming "द्विभास्थितान्" (with a clear आ-matra on भ) unambiguously. This verse parallels verse 3's rule (a dual-bodied sign does not behold itself) but restates it in terms of planets: a planet in a dual-bodied sign does not aspect another planet occupying the very same sign as itself. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दृष्टिचक्रन्यास-- दृष्टिचक्रस्य विन्यासं वक्ष्येऽथ ब्रह्मणोदितम् । विज्ञानमात्रतो यस्य दृष्टिभेदः प्रकाश्यते ॥ ६ ॥

drishtichakranyaasa-- drishtichakrasya vinyaasan vakshye'tha brahmanoditam | vijnaanamaatrato yasya drishtibhedah prakaashyate || 6 ||

अंग्रेज़ी अर्थ

[Subsection:] The placement of the aspect-chart (Drishtichakra-nyasa) -- Now (atha) I shall explain (vakshye) the arrangement (vinyaasam) of the aspect-chart (drishtichakrasya), as taught by Brahma (brahmana uditam), by mere understanding of which (yasya vijnaana-maatratah) the distinction of aspect (drishtibhedah) is made clear (prakaashyate).

हिन्दी अर्थ

[उपशीर्षक:] दृष्टिचक्रन्यास (दृष्टिचक्र की स्थापना) -- अब (अथ) मैं ब्रह्मा द्वारा कहे गए (ब्रह्मणोदितम्) दृष्टिचक्र (दृष्टिचक्रस्य) के विन्यास (विन्यासं) को कहूँगा (वक्ष्ये), जिसके (यस्य) केवल ज्ञान मात्र से (विज्ञानमात्रतः) दृष्टिभेद (दृष्टिभेदः) प्रकट हो जाता है (प्रकाश्यते)।

स्रोत: BPHS Ch.8, verse 6, opening a new subsection under the heading "दृष्टिचक्रन्यास--" (Drishtichakra-nyasa), immediately following the commentary block closing verses 4-5 ("॥ ४-५ ॥", scratchpad/bphs-p96-scan5.png, read silently as context, not transcribed). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.96 (printed page 65). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p96-v6l1.png, scratchpad/bphs-p96-v6l2.png at 1.8x), legible cleanly with no ambiguity; the closing verse-number "॥ ६ ॥" is clearly visible in the line-2 crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्राच्यामजवृषौ देयौ कर्कसिंहावुदग्दिशि । प्रतीच्यां क्रमतोऽवाच्यां तुलाली नक्रकुम्भकौ ॥ ७ ॥

praachyaamajavrishau deyau karkasinhaavudagdishi | pratiichyaan kramato'vaachyaan tulaalii nakrakumbhakau || 7 ||

अंग्रेज़ी अर्थ

In the East (praachyaam), Aja [Mesha/Aries] and Vrishabha [Taurus] (aja-vrishau) should be placed (deyau); Karka [Cancer] and Simha [Leo] (karka-sinhau) in the North direction (udak-dishi). In the West (pratiichyaam), in order (kramatah), Tula [Libra] and Ali [Vrishchika/Scorpio] (tulaa-alii); in the South (avaachyaam), Nakra [Makara/Capricorn] and Kumbha [Aquarius] (nakra-kumbhakau).

हिन्दी अर्थ

पूर्व दिशा में (प्राच्यां) अज [मेष] और वृषभ (अजवृषौ) रखे जाने चाहिए (देयौ); कर्क और सिंह (कर्कसिंहौ) उत्तर दिशा में (उदग्दिशि)। पश्चिम दिशा में (प्रतीच्यां) क्रमशः (क्रमतः) तुला और अलि [वृश्चिक] (तुलाली); दक्षिण दिशा में (अवाच्यां) नक्र [मकर] और कुम्भ (नक्रकुम्भकौ)।

स्रोत: BPHS Ch.8, verse 7, opening the Drishtichakra-nyasa subsection's actual diagram-construction instructions (promised in v.6): assigning the twelve signs to the four cardinal directions, two per direction (movable+fixed pair), continuing into the four corners in verse 8. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.96 (printed page 65, bottom). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p96-v7l1.png, scratchpad/bphs-p96-v7l2.png at 1.8x), legible cleanly with no ambiguity; the closing verse-number "॥ ७ ॥" is clearly visible in the line-2 crop. Sign names given via classical synonyms: अज (Aja, goat) = Mesha/Aries; अलि (Ali, bee) = Vrishchika/Scorpio; नक्र (Nakra, crocodile) = Makara/Capricorn. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ईशाने मिथुनं कोणे कन्यां वायव्यसंज्ञके । धनुर्विलिख्य नैऋत्यामाग्नेय्यां विलिखेज्झषम् ॥ ८ ॥

iishaane mithunan kone kanyaan vaayavyasanjnake | dhanurvilikhya nairritayaamaagneyyaan vilikhejjhasham || 8 ||

अंग्रेज़ी अर्थ

In the Ishana [corner, NE] (iishaane), Mithuna [Gemini] (mithunam); in the corner (kone) named Vayavya [NW] (vaayavya-sanjnake), Kanya [Virgo] (kanyaam). Having written (vilikhya) Dhanu [Sagittarius] (dhanuh) in the Nairrita [corner, SW] (nairritaayaam), one should write (vilikhet) Jhasha [Pisces, fish] (jhasham) in the Agneyi [corner, SE] (aagneyyaam).

हिन्दी अर्थ

ईशान कोण में (ईशाने) मिथुन (मिथुनं); वायव्य नामक कोण में (वायव्यसंज्ञके कोणे) कन्या (कन्यां)। नैऋत्य [कोण] में (नैऋत्यां) धनु (धनुः) लिखकर (विलिख्य) आग्नेय [कोण] में (आग्नेय्यां) झष [मीन] (झषम्) लिखे (विलिखेत्)।

स्रोत: BPHS Ch.8, verse 8, completing the Drishtichakra diagram-construction begun in verse 7: the four dual-bodied (dvisvabhava) signs are placed at the four intercardinal corners, completing the layout of all twelve signs around the eight compass points. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.96 (printed page 65, bottom). Read from the standard 600dpi full-page render and a wide zoom crop covering both lines together (scratchpad/bphs-p96-v8-wide.png at 1.6x, after narrower split crops proved insufficiently positioned), legible cleanly with no ambiguity; the closing verse-number "॥ ८ ॥" is clearly visible at the end of line 2. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुष्कोणाकारचक्रं विन्यस्यैवं दृशं दिशेत् । वर्तुलाकारतो वापि दृष्टेः कार्या विचारणा ॥ ९ ॥

chatushkonaakaarachakran vinyasyaivan drishan dishet | vartulaakaarato vaapi drishteh kaaryaa vichaaranaa || 9 ||

अंग्रेज़ी अर्थ

Having arranged (vinyasya) thus (evam) a quadrangular-shaped (chatushkona-aakaara) chakra (chakram), one should indicate (dishet) the aspect (drisham). Or (vaa api) alternatively in circular form (vartulaakaaratah) too, the reckoning (vichaaranaa) of aspect (drishteh) should be made (kaaryaa).

हिन्दी अर्थ

चतुष्कोणाकार (चतुष्कोणाकार) चक्र को (चक्रं) इस प्रकार (एवं) रखकर (विन्यस्य) दृष्टि (दृशं) दिखानी चाहिए (दिशेत्)। अथवा (वापि) वर्तुलाकार (वर्तुलाकारतः) रूप में भी दृष्टि की (दृष्टेः) विचारणा (विचारणा) की जानी चाहिए (कार्या)।

स्रोत: BPHS Ch.8, verse 9, closing the Drishtichakra-nyasa subsection opened in verse 6: after the compass-point sign-placements of verses 7-8, this verse notes the diagram may be drawn either as a quadrangular (chatushkonaakaara) or circular (vartulaakaara) figure, with aspect reckoned from either form. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.97 (printed page 65, cont'd / next leaf). Read from a fresh 600dpi full-page render (scratchpad/bphs-p97-600.png) and split zoom crops (scratchpad/bphs-p97-v9l1-fix.png, scratchpad/bphs-p97-v9l2-fix.png at 1.8x), legible cleanly with no ambiguity; the closing verse-number "॥ ९ ॥" is clearly visible at the end of line 2. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ सूतिकाध्यायः ॥ ९ ॥ पराशर उवाच-- अथाहं सूतिकाध्यायं वक्ष्यामि शृणु सुव्रत । पुरा प्रसङ्गवशतो ब्रह्मणा कथितं यथा ॥ १ ॥

atha suutikaadhyaayah || 9 || paraashara uvaacha-- athaahan suutikaadhyaayan vakshyaami shrinu suvrata | puraa prasangavashato brahmanaa kathitan yathaa || 1 ||

अंग्रेज़ी अर्थ

[Chapter 9:] The Sutika-chapter [on childbirth/postnatal matters] (Sutikaadhyaya) -- Parashara said: Now (atha) I (aham) shall tell (vakshyaami) the Sutika-chapter (sutikaadhyaayam); hear (shrinu), O virtuous one (suvrata), as (yathaa) it was told (kathitam) formerly (puraa) by Brahma (brahmanaa), arising in the course of a discussion (prasanga-vashatah).

हिन्दी अर्थ

[अध्याय ९:] सूतिकाध्यायः -- पराशर ने कहा: अब (अथ) मैं (अहं) सूतिकाध्याय (सूतिकाध्यायं) कहूँगा (वक्ष्यामि); हे सुव्रत (सुव्रत), सुनो (शृणु), जैसा (यथा) पूर्व काल में (पुरा) प्रसंगवश (प्रसङ्गवशतः) ब्रह्मा द्वारा (ब्रह्मणा) कहा गया था (कथितं)।

स्रोत: BPHS Chapter 9 opens: title "अथ सूतिकाध्यायः ॥ ९ ॥" (the chapter on Sutika/childbirth matters) appears immediately after Chapter 8's colophon on the same page. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.98 (printed page 66). Read from a fresh 600dpi full-page render (scratchpad/bphs-p98-600.png) and split zoom crops (scratchpad/bphs-p98-v1l1.png, scratchpad/bphs-p98-v1l2.png at 1.6x), with an additional 2.5x word-zoom (scratchpad/bphs-p98-v1l1-word.png) confirming "शृणु सुव्रत" is printed in the standard unadorned spelling here (unlike the "श्रृणु" variant seen in BPHS 8.1). Legible cleanly with no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यन्त्रैः स्पष्टतरो वेध्यो जन्मकालस्तथा पुनः । साध्याः स्पष्टखगाश्चैवं लग्नं साध्यं यथोदितम् ॥ २ ॥

yantraih spashtataro vedhyo janmakaalastathaa punah | saadhyaah spashtakhagaashchaivan lagnan saadhyan yathoditam || 2 ||

अंग्रेज़ी अर्थ

By instruments (yantraih), the birth-time (janmakaalah) should again (tathaa punah) be ascertained (vedhyah) still more precisely (spashtatarah); thus (evam) the exact planets['-positions] (spashta-khagaah) are to be computed (saadhyaah), and likewise (cha) the ascendant (lagnam) is to be computed (saadhyam) as already stated (yathoditam) [i.e. by the methods described in earlier chapters].

हिन्दी अर्थ

यन्त्रों द्वारा (यन्त्रैः) जन्म-काल (जन्मकालः) को पुनः (पुनः) और अधिक स्पष्टता से (स्पष्टतरः) जानना चाहिए (वेध्यः); इस प्रकार (एवं) स्पष्ट ग्रहों की [स्थिति] (स्पष्टखगाः) साधनीय है (साध्याः), और उसी प्रकार (च) लग्न (लग्नं) भी पूर्वोक्त रीति से (यथोदितम्) साधनीय है (साध्यं)।

स्रोत: BPHS Ch.9, verse 2, immediately following verse 1's opening. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.98 (printed page 66). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p98-v2l1.png, scratchpad/bphs-p98-v2l2.png at 1.8x), legible cleanly with no ambiguity; the closing verse-number "॥ २ ॥" is clearly visible at the end of line 2. The verse refers back to instrument-based (yantra) refinement of birth-time and the planetary/ascendant computation methods taught in earlier chapters, without repeating them here. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नद्वादशभावेषु ग्रहाः स्थाप्या, दिवाजनौ । सूर्यो रात्रौ सूर्यपुत्रौ जनकौ परिकीर्तितौ ॥ ३ ॥

lagnadvaadashabhaaveshu grahaah sthaapyaa, divaajanau | suuryo raatrau suuryaputrau janakau parikiirtitau || 3 ||

अंग्रेज़ी अर्थ

The planets (grahaah) are to be established (sthaapyaah) in the ascendant and the twelve houses (lagna-dvaadasha-bhaveshu). By day (divaa) [it is] the Sun (suuryah); by night (raatrau), the son of the Sun [i.e. Saturn] (suurya-putrah) -- these two (janakau) are declared (parikiirtitau) the genitor-significators. [The lone word read as "जनौ" printed at the end of line 1, before "सूर्यो" opens line 2, remains textually unresolved -- see source note; it does not affect the overall sense, which the following Hindi commentary confirms directly: Sun by day and Saturn by night as father-significator.]

हिन्दी अर्थ

ग्रह (ग्रहाः) लग्न और द्वादश भावों में (लग्नद्वादशभावेषु) स्थापित किए जाने चाहिए (स्थाप्या)। दिन में (दिवा) सूर्य (सूर्यः), रात्रि में (रात्रौ) सूर्य का पुत्र अर्थात् शनि (सूर्यपुत्रः) -- ये दोनों (जनकौ) पितृ-संज्ञक ग्रह कहे गए हैं (परिकीर्तितौ)। [पंक्ति १ के अंत में "सूर्यो" से पहले छपा "जनौ" शब्द इस श्लोक मात्र से पूर्णतः स्पष्ट नहीं होता -- स्रोत-टिप्पणी देखें; किन्तु समग्र अर्थ आगे की हिन्दी टीका से स्पष्ट हो जाता है: दिन में सूर्य और रात्रि में शनि पितृ-संज्ञक ग्रह हैं।]

स्रोत: BPHS Ch.9, verse 3. UPDATED after reading the corroborating Hindi commentary (scratchpad/bphs-p98-lower1.png), which states directly: "दिन में जन्म समय हो तो सूर्य को और रात्रि में जन्मसमय हो तो शनि को पिता समझें" (if the birth-time is by day, consider the Sun as father; if by night, consider Saturn as father) -- resolving the verse's overall sense: the Sun (day) and Saturn, "son of the Sun" (night), are jointly declared (dual "जनकौ परिकीर्तितौ") the genitor/father-significators. One residual textual uncertainty remains disclosed rather than forced: a word read as "जनौ" is printed at the very end of line 1 (immediately before line 2 opens with "सूर्यो"), confirmed unambiguously at high zoom to read those exact letters (scratchpad/bphs-p98-v3-divajanau.png), but its precise grammatical role in the sentence is not established by the verse or the commentary read so far. "सूर्यपुत्रौ" (confirmed at high zoom, scratchpad/bphs-p98-v3-suryaputra.png) is read as "सूर्यपुत्रः" (son of the Sun, i.e. Saturn) inflected to agree in the shared dual predicate "जनकौ परिकीर्तितौ" together with "सूर्यः", per standard Sanskrit elliptical dual-agreement across a day/night pair, rather than literally "two sons of the Sun." Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.98 (printed page 66). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तथैव सितचन्द्रौ तु विज्ञेयौ मातृसंज्ञितौ । तयोर्मध्ये बली यः स्यात्तस्य गेहे जनिर्भवेत् ॥ ४ ॥

tathaiva sitachandrau tu vijneyau maatrisanjnitau | tayormadhye balii yah syaattasya gehe janirbhavet || 4 ||

अंग्रेज़ी अर्थ

Likewise (tathaiva), Venus and the Moon (sita-chandrau) are to be known (vijneyau) as designated (sanjnitau) the two 'mother' [significators] (maatri). Between the two of them (tayoh madhye), whichever (yah) should be stronger (balii syaat) -- in that one's house/domain (tasya gehe) the birth (janih) occurs (bhavet).

हिन्दी अर्थ

उसी प्रकार (तथैव) शुक्र और चन्द्रमा (सितचन्द्रौ) मातृ-संज्ञक (मातृसंज्ञितौ) जानने चाहिए (विज्ञेयौ)। उन दोनों में से (तयोर्मध्ये) जो (यः) बलवान् हो (बली स्यात्), उसी के घर में (तस्य गेहे) जन्म होता है (जनिर्भवेत्)।

स्रोत: BPHS Ch.9, verse 4, continuing immediately from verse 3's day/night genitor-significator rule with the corresponding pair of 'mother' significators (Venus and Moon), and a strength-comparison rule for determining which one's house governs the birth. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.98 (printed page 66). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p98-commentary1.png for lines 1-2, with an additional 3x word-zoom scratchpad/bphs-p98-v4l2-word.png confirming "बली" [strong] rather than a similar-looking "वली"), legible cleanly with no ambiguity; the closing verse-number "॥ ४ ॥" is clearly visible. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रात्रौ जन्म-- नीचराशिगताः सौम्या ग्रहदृष्टिविवर्जिताः । चन्द्रो यदि भवेल्लग्ने पथि जन्म विनिर्दिशेत् ॥ ५ ॥

raatrau janma-- niicharaashigataah saumyaa grahadrishtivivarjitaah | chandro yadi bhavellagne pathi janma vinirdishet || 5 ||

अंग्रेज़ी अर्थ

[Subsection:] Birth at night (raatrau janma) -- If (yadi) the Moon (chandrah), gentle [i.e. the Moon itself] (saumyaa), situated in a debilitated sign (niicha-raashi-gataah), devoid of aspect from [any] planet (graha-drishti-vivarjitaah), should be (bhavet) in the ascendant (lagne), it should indicate (vinirdishet) that the birth (janma) [occurs] on a path/road (pathi).

हिन्दी अर्थ

[उपशीर्षक:] रात्रौ जन्म (रात्रि में जन्म) -- यदि (यदि) चन्द्रमा (चन्द्रः), नीच राशि में स्थित (नीचराशिगताः), किसी भी ग्रह की दृष्टि से रहित (ग्रहदृष्टिविवर्जिताः), लग्न में हो (भवेल्लग्ने), तो यह मार्ग में (पथि) जन्म (जन्म) होने का संकेत करे (विनिर्दिशेत्)।

स्रोत: BPHS Ch.9, verse 5, opening a new subsection under the Hindi editorial heading "रात्रौ जन्म--" (birth at night), immediately after the commentary block closing verses 1-4 ("॥ १-४ ॥", scratchpad/bphs-p98-lower2.png, read silently as context, not transcribed) explicitly confirmed Sun (day)/Saturn (night) as father-significators and Venus/Moon as mother-significators, matching the resolved reading of verse 3. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.98 (printed page 66). Read from the standard 600dpi full-page render and a combined zoom crop (scratchpad/bphs-p98-v5.png at 1.7x), legible cleanly with no ambiguity; the closing verse-number "॥ ५ ॥" is clearly visible. The immediately following commentary (scratchpad/bphs-p98-v6.png) corroborates this exact reading and closes with "॥ ५ ॥" confirming verse 5 stands alone (not grouped with adjacent verses). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सूतिकागृहे प्रकाशज्ञानम्-- सबलो भौमदृष्टश्च स्वक्षेत्रादिषु संस्थितः । सूर्यो यदा तदा ज्ञेयं बहुदीपान्वितं गृहम् ॥ ६ ॥

suutikaagrihe prakaashajnaanam-- sabalo bhaumadrishtashcha svakshetraadishu sansthitah | suuryo yadaa tadaa jneyan bahudiipaanvitan griham || 6 ||

अंग्रेज़ी अर्थ

[Subsection:] Knowledge of light in the birthing-room (Sutikagrihe prakaashajnaanam) -- When (yadaa) the Sun (suuryah) is strong (sabalah) and aspected by Mars (bhauma-drishtah cha), situated (sansthitah) in its own sign or the like [dignity] (sva-kshetra-aadishu), then (tadaa) the [birthing] house (griham) is to be known (jneyam) as furnished with many lamps (bahu-diipa-anvitam).

हिन्दी अर्थ

[उपशीर्षक:] सूतिकागृहे प्रकाशज्ञानम् (सूतिकागृह में प्रकाश का ज्ञान) -- जब (यदा) सूर्य (सूर्यः) बलवान् हो (सबलः) और मंगल से दृष्ट हो (भौमदृष्टश्च), स्वक्षेत्र आदि में स्थित हो (स्वक्षेत्रादिषु संस्थितः), तब (तदा) घर (गृहम्) को बहुत दीपकों से युक्त (बहुदीपान्वितं) जानना चाहिए (ज्ञेयं)।

स्रोत: BPHS Ch.9, verse 6, opening a further subsection under the Hindi editorial heading "सूतिकागृह में प्रकाश ज्ञान--" (knowledge of light in the birthing-room). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.98 (printed page 66). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p98-sandhi.png for line 1 and the heading, scratchpad/bphs-p98-v6l2-clear.png at 2x for line 2), legible cleanly with no ambiguity; the closing verse-number "॥ ६ ॥" is clearly visible in the line-2 crop. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जलभांशगतश्चन्द्रश्चतुर्थे भवने भवेत् । युक्तो मन्देन वा दृष्टोऽन्धकारे जायते जनिः ॥ ७ ॥

jalabhaanshagatashchandrashchaturthe bhavane bhavet | yukto mandena vaa drishto'ndhakaare jaayate janih || 7 ||

अंग्रेज़ी अर्थ

If the Moon (chandrah), situated in a watery [sign's] amsha [i.e. navamsha] (jala-bha-ansha-gatah), should be (bhavet) in the fourth house (chaturthe bhavane), conjoined with (yuktah) or (vaa) aspected by (drishtah) Saturn (mandena), the birth (janih) occurs (jaayate) in darkness (andhakaare).

हिन्दी अर्थ

यदि (यदि) चन्द्रमा (चन्द्रः) जलतत्त्व राशि के अंश [नवांश] में स्थित होकर (जलभांशगतः) चतुर्थ भाव में हो (चतुर्थे भवने भवेत्), और शनि से युक्त (युक्तो मन्देन) या दृष्ट हो (वा दृष्टः), तो जन्म (जनिः) अन्धकार में (अन्धकारे) होता है (जायते)।

स्रोत: BPHS Ch.9, verse 7, contrasting verse 6's rule (many lamps when the Sun is strong, Mars-aspected, and in own sign) with the opposite condition: a Moon in a watery navamsha in the 4th house, conjoined with or aspected by Saturn, giving birth in darkness. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.98 (printed page 66, bottom). Read from the standard 600dpi full-page render and a combined zoom crop (scratchpad/bphs-p98-v7-full.png at 1.8x), legible cleanly with no ambiguity; the closing verse-number "॥ ७ ॥" is clearly visible. Confirmed via an adjacent crop (scratchpad/bphs-p98-gap.png) that verse 6 closes directly with "॥ ६ ॥" and verse 7 begins on the very next line with no intervening commentary on this page (the CC-0/eGangotri digitization watermark sits just below verse 7's line, not overlapping any verse text). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दीपादिज्ञान-- यस्मिन् भागे भवेत्सूर्यस्तत्र दीपं वदेत् सुधीः । लग्नाद्वर्त्तिस्तथा चन्द्रात्तैलं वाच्यं मनीषिभिः ॥ ८ ॥

diipaadijnaana-- yasmin bhaage bhavetsuuryastatra diipan vadet sudhiih | lagnaadvarttistathaa chandraattailan vaachyan maniishibhih || 8 ||

अंग्रेज़ी अर्थ

[Subsection:] Knowledge of the lamp, etc. (diipaadi-jnaana) -- In whatever part [of the chart] (yasmin bhaage) the Sun (suuryah) should be (bhavet), there (tatra) the wise (sudhiih) should declare (vadet) the lamp (diipam) [to be placed]. Likewise (tathaa), the wick (varttih) [is known] from the ascendant (lagnaat), and the oil (tailam) is to be declared (vaachyam) by the wise (maniishibhih) from the Moon (chandraat).

हिन्दी अर्थ

[उपशीर्षक:] दीपादिज्ञान (दीपक आदि का ज्ञान) -- सूर्य (सूर्यः) जिस भाग में (यस्मिन् भागे) हों (भवेत्), उसी भाग में (तत्र) दीपक (दीपं) की स्थिति बुद्धिमान् को कहनी चाहिए (वदेत् सुधीः)। उसी प्रकार (तथा) लग्न से (लग्नात्) बत्ती (वर्त्तिः) जाननी चाहिए, और चन्द्रमा से (चन्द्रात्) तेल (तैलं) बुद्धिमानों द्वारा (मनीषिभिः) कहा जाना चाहिए (वाच्यं)।

स्रोत: BPHS Ch.9, verse 8, opening a subsection under the Hindi editorial heading "दीपादिज्ञान--" (knowledge of the lamp, etc.). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.99 (printed page 67). Read from a fresh 600dpi full-page render (scratchpad/bphs-p99-600.png) and split zoom crops (scratchpad/bphs-p99-v8-both.png, scratchpad/bphs-p99-v8l2-word.png at 2.8x for the line-2 compound), legible cleanly with no ambiguity. Directly corroborated by the immediately following Hindi commentary (scratchpad/bphs-p99-commentary.png): "जिस भाग में सूर्य अवस्थित हों घर के उसी भाग में दीप की स्थिति कहनी चाहिये। लग्न से वर्त्ती, और चन्द्रमा से तेल का ज्ञान करें।" English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चरेऽर्के चञ्चलो दीपः स्थिरर्क्षे तु स्थिरो भवेत् । द्विभे स्थितिर्द्वयोर्ज्ञेया सूर्यक्षेत्रगतो बुधैः ॥ ९ ॥

chare'rke chanchalo diipah sthirarkshe tu sthiro bhavet | dvibhe sthitirdvayorjneyaa suuryakshetragato budhaih || 9 ||

अंग्रेज़ी अर्थ

When [the Sun is] in a movable/cardinal sign (chare arke), the lamp (diipah) is flickering (chanchalah); but (tu) when in a fixed sign (sthira-rkshe), it should be (bhavet) steady (sthirah). When [the Sun is] in a dual-bodied [common] sign (dvibhe -- an elliptical form for dvisvabhava-raashau, confirmed by the following commentary), the status of both (sthitih dvayoh) [i.e. sometimes steady, sometimes flickering] is to be known (jneyaa) by the wise (budhaih), since [the Sun] is so situated (suurya-kshetra-gatah).

हिन्दी अर्थ

जब सूर्य चर राशि में हों (चरेऽर्के) तब दीपक (दीपः) चञ्चल (चञ्चलः) होता है; परन्तु (तु) स्थिर राशि में हों (स्थिरर्क्षे) तो दीपक स्थिर होना चाहिए (स्थिरो भवेत्)। द्विस्वभाव राशि में (द्विभे) सूर्य स्थित होने पर (सूर्यक्षेत्रगतो) दोनों की स्थिति (स्थितिर्द्वयोः) बुद्धिमानों को जाननी चाहिए (ज्ञेया बुधैः) [अर्थात् दीपक कभी स्थिर और कभी चञ्चल कहना चाहिए]।

स्रोत: BPHS Ch.9, verse 9, continuing directly from verse 8. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.99 (printed page 67). Read from the standard 600dpi full-page render and split word-level zoom crops (scratchpad/bphs-p99-v9l1-word1.png, -word2b.png for line 1's "चरेऽर्के चञ्चलो"; scratchpad/bphs-p99-v9l2-w1b.png, -w1c.png, -mid2.png, -mid3.png for line 2's "द्विभे स्थितिर्द्वयोर्ज्ञेया सूर्यक्षेत्रगतो बुधैः"). The word "द्विभे" (literally "in the two-fold sign") was initially ambiguous on its own, but the immediately following Hindi commentary (scratchpad/bphs-p99-commentary.png) resolves it explicitly and in full: "जन्म समय में चर राशि में सूर्य रहें तो दीप चञ्चल (दीपक लेकर कोई इधर उधर करे), स्थिर राशि में हों तो दीपक स्थिर, और द्विस्वभाव राशिगत सूर्य हों तो दीपक कभी स्थिर और कभी चञ्चल कहना चाहिये" -- confirming "द्विभे" denotes a dvisvabhava (dual-natured/common) sign, and the verse's three-way chara/sthira/dvisvabhava structure. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जन्मज्ञान-- शीर्षाच्छीर्षोदये वाच्यः पादात् पृष्ठोदये मतः । करात्तदुभये ज्ञेयः प्रसवः सर्वदेहिनाम् ॥ १० ॥

janmajnaana-- shiirshaachchhiirshodaye vaachyah paadaat prishthodaye matah | karaattadubhaye jneyah prasavah sarvadehinaam || 10 ||

अंग्रेज़ी अर्थ

[Subsection:] Knowledge of [the manner of] birth (janma-jnaana) -- From [the] head [emerging first] (shiirshaat), it is to be called (vaachyah) head-first birth (shiirshodaye); from the foot (paadaat), it is considered (matah) back/breech-first birth (prishthodaye). From the hand [emerging first] (karaat), the birth (prasavah) of all embodied beings (sarva-dehinaam) is to be known (jneyah) as a mixture of both (tad-ubhaye).

हिन्दी अर्थ

[उपशीर्षक:] जन्मज्ञान (जन्म के प्रकार का ज्ञान) -- सिर से [पहले निकलने पर] (शीर्षात्) शीर्षोदय जन्म कहा जाना चाहिए (वाच्यः शीर्षोदये); पैर से (पादात्) पृष्ठोदय जन्म माना जाता है (पृष्ठोदये मतः)। हाथ से [पहले निकलने पर] (करात्) सभी प्राणियों का (सर्वदेहिनाम्) जन्म (प्रसवः) दोनों का मिश्रण (तदुभये) जानना चाहिए (ज्ञेयः)।

स्रोत: BPHS Ch.9, verse 10, opening a subsection under the Hindi editorial heading "जन्मज्ञान--" (knowledge of the manner of birth), describing three delivery-presentation types: head-first (shirshodaya), feet-first (prishthodaya), and hand-first (a mixture of both). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.100 (printed page 68, immediately following the "॥ ८-९ ॥" commentary-closing marker on PDF p.99). Read from a fresh 600dpi full-page render (scratchpad/bphs-p100-600.png) and split zoom crops (scratchpad/bphs-p100-v10l1-fix.png, scratchpad/bphs-p100-v10l2-fix.png at 2.2x), legible cleanly with no ambiguity; the closing verse-number "॥ १० ॥" is clearly visible. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सूतिका गृह द्वार ज्ञान-- केन्द्रस्थग्रहयोगाद्वा लग्नर्क्षाद्वा बलाधिकात् । द्वारं वाच्यं तु गेहस्य दिगीशक्रमतः सदा ॥ ११ ॥

suutikaa griha dvaara jnaana-- kendrasthagrahayogaadvaa lagnarkshaadvaa balaadhikaat | dvaaran vaachyan tu gehasya digiishakramatah sadaa || 11 ||

अंग्रेज़ी अर्थ

[Subsection:] Knowledge of the birthing-house's door (suutikaa-griha-dvaara-jnaana) -- Either from a planet's conjunction situated in a kendra (kendra-stha-graha-yogaat vaa), or from the ascendant-sign (lagna-rkshaat vaa), whichever is stronger (balaadhikaat), the door (dvaaram) of the house (gehasya) should always (sadaa) be declared (vaachyam) according to the sequence of the lords of the directions (dig-iisha-kramatah).

हिन्दी अर्थ

[उपशीर्षक:] सूतिका गृह द्वार ज्ञान (सूतिकागृह के द्वार का ज्ञान) -- केन्द्र में स्थित ग्रह के योग से (केन्द्रस्थग्रहयोगाद्वा), या लग्न-राशि से (लग्नर्क्षाद्वा), जो भी बलवान् हो (बलाधिकात्), उसी के अनुसार घर का (गेहस्य) द्वार (द्वारं) दिशाओं के स्वामियों के क्रम से (दिगीशक्रमतः) सदा (सदा) कहना चाहिए (वाच्यं तु)।

स्रोत: BPHS Ch.9, verse 11, opening a subsection under the Hindi editorial heading "सूतिका गृह द्वार ज्ञान--" (knowledge of the birthing-house's door), immediately after the commentary on verse 10 closes with "॥ १० ॥" (confirmed at zoom, scratchpad/bphs-p100-closingnum2.png, correcting an initial misread as "॥ ११ ॥"). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.100 (printed page 68). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p100-v11l1-fix.png, scratchpad/bphs-p100-v11l2.png at 2-2.3x, with an additional 3.5x word-zoom scratchpad/bphs-p100-v11l1-word2.png confirming "लग्नर्क्षाद्वा" precisely), legible cleanly with no ambiguity; the closing verse-number "॥ ११ ॥" is clearly visible. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

उपसूतिका ज्ञान-- लग्नचन्द्रान्तरालस्थग्रहैः स्युरुपसूतिकाः । दृश्याद्दृश्यविभागाभ्यां बहिरन्तश्च ताः स्मृताः ॥ १२ ॥

upasuutikaa jnaana-- lagnachandraantaraalasthagrahaih syurupasuutikaah | drishyaaddrishyavibhaagaabhyaam bahirantashcha taah smritaah || 12 ||

अंग्रेज़ी अर्थ

[Subsection:] Knowledge of the upa-sutikas [auxiliary female birth-attendants] (upasuutikaa-jnaana) -- The upa-sutikas (upasuutikaah) are (syuh) equal in number to the planets (grahaih) situated in the interval between the ascendant and the Moon (lagna-chandra-antaraala-sthah) [i.e., their count equals the count of such planets]. By the planets' division into visible and invisible (drishya-adrishya-vibhaagaabhyaam), they (taah) are remembered (smritaah) as external and internal (bahih antah cha) [respectively].

हिन्दी अर्थ

[उपशीर्षक:] उपसूतिका ज्ञान (सहायक सूतिका-स्त्रियों का ज्ञान) -- लग्न और चन्द्रमा के मध्य के अन्तराल में स्थित ग्रहों की संख्या के तुल्य (लग्नचन्द्रान्तरालस्थग्रहैः) उपसूतिकाएँ होती हैं (स्युरुपसूतिकाः) [अर्थात् उतने ही ग्रह हों उतनी ही उपसूतिकाएँ जाननी चाहिए]। ग्रहों के दृश्य और अदृश्य विभाग से (दृश्याद्दृश्यविभागाभ्यां) वे (ताः) बाह्य और आन्तरिक (बहिरन्तश्च) स्मरण की जाती हैं (स्मृताः)।

स्रोत: BPHS Ch.9, verse 12, opening a new subsection under the Hindi editorial heading "उपसूतिका ज्ञान--" (knowledge of the upa-sutikas / auxiliary birth-attendant planets), immediately after the commentary on verse 11 -- which quotes Varahamihira ("द्वारं तद् वास्तुनि केन्द्रसंस्थैर्ज्ञेयं ग्रहैर्वीर्य-समन्वितैर्वा", read silently as context, not transcribed) and a further quoted verse attributed to Manishtha ("लग्ने यो द्विरशांशस्तदभिमुखं सूतिकागृहे द्वारम्", scratchpad/bphs-p100-mid3.png -- an external citation embedded in the editor's commentary, correctly excluded from transcription as BPHS verse content, consistent with the Saaravalii-citation exclusion on PDF p.99) -- closes. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.100 (printed page 68). Read from the standard 600dpi full-page render and a combined zoom crop (scratchpad/bphs-p100-v12-full.png at 1.6x), with additional word-level zooms (scratchpad/bphs-p100-v12l2-word4.png, -word5.png at 4x) confirming line 2's compound; the closing verse-number "॥ १२ ॥" is clearly visible. Note: line 2's compound is printed with a doubled-द conjunct, "दृश्याद्दृश्यविभागाभ्यां" (drishya-ad-drishya-...), rather than the single-द sandhi form one might expect for drishya+adrishya (drishyaadrishya-); transcribed exactly as printed per zero-fabrication discipline, without silently normalizing the orthography -- the evident sense (division into "visible" and "invisible" [planets], drishya-adrishya) is unaffected by this orthographic doubling. English/Hindi meanings by Vedic Hora -- for review. CORRECTION (via the immediately following Hindi commentary, scratchpad/bphs-p100-v13-commentary.png): "लग्न चन्द्रमा के बीच विद्यमान ग्रहों की संख्या तुल्य उपसूतिकाएँ (जन्म समय सूतिका के साथ रहनेवाली स्त्रियाँ) कहनी चाहिए। दृश्य तथा अदृश्य विभागों के ..." -- this clarifies that upa-sutikaas are human female birth-attendants (women who stay with the mother/sutika at the time of birth) whose NUMBER equals the count of planets between lagna and Moon, rather than the planets themselves 'becoming' the attendants as an earlier reading of the bare verse suggested; translation and translationHi revised accordingly via scratchpad/fix-bphs-ch9-v12.js.

संस्कृत

स्वक्षादौ द्विगुणा ज्ञेया वक्रोच्चे त्रिगुणा मताः । यत्रोभयस्य सम्प्राप्तिस्त्रैगुण्यं तत्र वै सकृत् ॥ १३ ॥

svakshaadau dviguna jneyaa vakrocche triguna mataah | yatrobhayasya sampraaptistraigunyan tatra vai sakrit || 13 ||

अंग्रेज़ी अर्थ

For a planet in its own sign, etc. (sva-kshetra-aadau), [the count] should be known as doubled (dviguna jneyaa). For one retrograde or exalted (vakra-uchche), [it is] held to be tripled (triguna mataah). Where (yatra) the attainment of both [conditions in a single planet] (ubhayasya sampraaptih) [occurs], the tripling (traigunyam) [is applied] there (tatra) only once (vai sakrit).

हिन्दी अर्थ

अपनी राशि आदि में स्थित ग्रह के लिए (स्वक्षादौ) [गणना] दुगुनी जाननी चाहिए (द्विगुणा ज्ञेया)। वक्री अथवा उच्च के होने पर (वक्रोच्चे) तिगुनी मानी गई है (त्रिगुणा मताः)। जहाँ (यत्र) दोनों [स्थितियों] की प्राप्ति एक साथ हो (उभयस्य सम्प्राप्तिः), वहाँ (तत्र) त्रिगुणा करना केवल एक ही बार (सकृत्) करना चाहिए, दो बार नहीं।

स्रोत: BPHS Ch.9, verse 13, continuing the upa-sutika-counting rules from verse 12 (multiplier rules layered on top of the base count established in verse 12), immediately before the intervening unattributed commentary-embedded couplet on widows/married-women (excluded from transcription; see the source note on verse 9.14). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.100 (printed page 68). Read from the standard 600dpi full-page render and split zoom crops (scratchpad/bphs-p100-v13l1-word.png, -word2.png at 2.5-3x, scratchpad/bphs-p100-v13l2-full.png at 1.6x); the closing verse-number "॥ १३ ॥" is clearly legible. The opening compound's ending vowel sign was initially ambiguous between "स्वक्षादा" and "स्वक्षादौ" even after repeated re-zooming up to ~5-6x (scratchpad/bphs-p100-v13l1-w3.png reached a pixel-blur resolution ceiling with no further legible detail) -- this was resolved not by further zooming but by corroboration from the very next page's Hindi commentary on this verse (scratchpad/bphs-p101-top.png: "...स्वगृहादि तथा वक्रत्वादि दोनों स्थिति...", explicitly discussing 'own-house etc.' AND 'retrograde-etc.' as the two doubling/tripling conditions), confirming the reading "स्वक्षादौ" (sva-kshetra-aadau, locative, "in [its] own sign, etc.") rather than "स्वक्षादा". This resolution was obtained before this verse was seeded, so no separate fix script was needed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चिह्नज्ञान-- कालाङ्गे यत्र भौमाङ्कौ तत्र ज्ञेयं तिलादिकम् ॥ १४ ॥

chihnajnaana-- kaalaange yatra bhaumaankau tatra jneyan tilaadikam || 14 ||

अंग्रेज़ी अर्थ

[Subsection:] Knowledge of [bodily] marks (chihna-jnaana) -- [With respect to Mars (bhauma-), in the manner indicated by the opening compound (kaalaange -- exact sense uncertain, see note)], wherever (yatra) [Mars's influence falls], there (tatra) a mole or similar mark (tila-aadikam) should be known (jneyam).

हिन्दी अर्थ

[उपशीर्षक:] चिह्नज्ञान (शरीर के चिह्नों/तिलों का ज्ञान) -- मंगल (भौम) से सम्बन्धित [आरम्भिक शब्द "कालाङ्गे" का ठीक-ठीक अर्थ अनिश्चित है, नीचे टिप्पणी देखें], जहाँ भी [मंगल का प्रभाव हो], वहाँ (तत्र) तिल आदि चिह्न (तिलादिकम्) जानना चाहिए (ज्ञेयं)।

स्रोत: BPHS Ch.9, verse 14, opening a new subsection under the Hindi editorial heading "चिह्नज्ञान--" (knowledge of bodily marks/moles), immediately after the grouped commentary on verses 12-13 closes with "॥ १२-१३ ॥" (scratchpad/bphs-p101-mid6.png). NOTE on an intervening line: directly after verse 13's own closing "॥ १३ ॥" on PDF p.100, a single unnumbered Sanskrit line appears -- "पापैस्तु विधवा ज्ञेयाः शोभनैः सधवाः स्मृताः ।" (scratchpad/bphs-p100-v14-fullwidth.png) -- ending in a single danda with no verse number and no second line; the Hindi commentary that follows it (scratchpad/bphs-p100-bottom-full.png, scratchpad/bphs-p101-mid1.png: "...लग्न तथा चन्द्रमा के बीच स्थित पाप ग्रहों की संख्या के समान विधवाएँ तथा शुभ ग्रहों की संख्या के बराबर सधवाएँ कहनी चाहिए।") explains it as an extension of the verse-12/13 counting method to malefic/benefic planets (malefic count = widows, benefic count = married women among the upa-sutikas), and the whole discussion -- including a further embedded quotation from Varahamihira (scratchpad/bphs-p101-mid2.png, in quotes, external citation excluded) and from Laghu Jataka (scratchpad/bphs-p101-mid4.png, in quotes, external citation excluded) on the drishya/adrishya chakrardha division -- closes together under the single grouped marker "॥ १२-१३ ॥", never under a "१४". This confirms the widow/married couplet is NOT an independently numbered BPHS root verse (it is commentary-embedded exposition attached to verses 12-13) and it has accordingly been excluded from transcription as verse content, consistent with the external-citation-exclusion technique used elsewhere in this chapter. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.101 (printed page 69, confirmed via the visible page-top chapter-heading "सूतिकाध्यायः" and page number, scratchpad/bphs-p101-top.png). Verse 14 itself is read from a 600dpi full-page render and zoom crops (scratchpad/bphs-p101-v14line.png at 2.5x, scratchpad/bphs-p101-v14-w1.png, -w2.png at 4x, scratchpad/bphs-p101-v14-w1z.png, -w2z.png at 6x); the closing verse-number "॥ १४ ॥" and the words "यत्र", "तत्र", "ज्ञेयं", "तिलादिकम्", and "भौम" (Mars) are clearly legible. However, the two compounds "कालाङ्गे" (opening word) and "भौमाङ्कौ" remain genuinely uncertain at the glyph level even after repeated re-zooming up to 6x -- the scan's print resolution is exhausted at this point (further zoom produces only pixel blur, no new legible detail). Plausible alternate readings include "भौमार्कौ" (Mars-and-Sun, dual, which would parallel verse 15's dual-subject "शनिराहू स्थितौ" structure) instead of "भौमाङ्कौ", and the opening word could plausibly be a different compound than "कालाङ्गे" as transcribed. No immediately following Hindi commentary was found to corroborate this specific verse (the text moves directly to verse 15's parallel rule on Saturn-Rahu and Moon-Mars-Venus placements, scratchpad/bphs-p101-v14-commentary.png). Given this irreducible ambiguity, the Sanskrit/IAST are transcribed as the most legible reading and the translation is deliberately limited to the clearly legible portion (the general chihna-jnaana rule involving Mars and a mole/mark), without asserting a specific resolution of the uncertain compounds. English/Hindi meanings by Vedic Hora -- for review; this verse's exact wording may need re-examination against a second copy of this edition or higher-resolution scan.

संस्कृत

शनिराहू स्थितौ यत्र तत्र श्यामलभादिशेत् । लग्ने चन्द्रारशुक्राश्चेत्चिह्नं शिरसि संस्थितम् ॥ १५ ॥

shaniraahuu sthitau yatra tatra shyaamalabhaadishet | lagne chandraarashukraashchetchihnan shirasi sansthitam || 15 ||

अंग्रेज़ी अर्थ

Wherever (yatra) Saturn and Rahu (shani-raahuu) are situated (sthitau), there (tatra) a dark [mark] should be declared (shyaamala-[bha]-aadishet [see note on this compound's exact parsing below]). If (chet) Moon, Mars and Venus (chandra-ara-shukraah) [are] in the ascendant (lagne), the mark (chihnam) is located (sansthitam) on the head (shirasi).

हिन्दी अर्थ

जहाँ (यत्र) शनि और राहु (शनिराहू) स्थित हों (स्थितौ), वहाँ (तत्र) श्यामल [चिह्न] कहना चाहिए (श्यामलभादिशेत् -- इस शब्द के ठीक-ठीक विग्रह हेतु नीचे टिप्पणी देखें)। यदि (चेत्) लग्न में (लग्ने) चन्द्र, मंगल और शुक्र (चन्द्रारशुक्राः) हों, तो चिह्न (चिह्नं) सिर पर (शिरसि) स्थित होता है (संस्थितम्)।

स्रोत: BPHS Ch.9, verse 15, continuing the "चिह्नज्ञान" (knowledge of bodily marks/moles) subsection opened at verse 14, in immediate succession after it with no intervening commentary block (scratchpad/bphs-p101-v14-commentary.png, which was found on inspection to already contain this verse's own text rather than commentary on verse 14). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.101 (printed page 69, confirmed via the visible page-top chapter-heading "सूतिकाध्यायः ६९", scratchpad/bphs-p101-top.png). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p101-v15-full.png at 2x, scratchpad/bphs-p101-v15l1-word.png at 3x); the closing verse-number "॥ १५ ॥" and the words "शनिराहू", "स्थितौ", "यत्र", "तत्र", "लग्ने", "चेत्", "चिह्नं", "शिरसि", "संस्थितम्" are all clearly legible with no ambiguity. "चन्द्रारशुक्राः" is read as chandra + ara (an abbreviated reference to Mars/Angaaraka) + shukraah, i.e. Moon-Mars-Venus, consistent with the verse's overall sense (paralleling the Saturn-Rahu pairing in line 1 with a Moon-Mars-Venus grouping in line 2). One compound's internal word-division is not fully certain: "श्यामलभादिशेत्" is printed as a single unbroken string (scratchpad/bphs-p101-v15l1-word.png) whose most probable segmentation is shyaamalam + [bha] + aadishet ("should declare/indicate [it as] dark[-hued]"), but the middle syllable's exact grammatical role could not be independently confirmed at this zoom level; transcribed and translated per this most probable reading, per the disclosure-without-forced-resolution technique, without asserting full certainty on the internal segmentation. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुक्रेऽस्ते निधने राहुः वामकर्णेऽथ मस्तके । गुरुः शुक्रोऽथवा भौमो यदि घ्ने व्यवस्थितः ॥ १६ ॥

shukre'ste nidhane raahuh vaamakarne'tha mastake | guruh shukro'thavaa bhaumo yadi ghne vyavasthitah || 16 ||

अंग्रेज़ी अर्थ

Venus (shukre) [being] in the 7th [setting] house or the 8th [house of death] (aste nidhane), Rahu (raahuh) [being] in the left ear or on the head (vaama-karne atha mastake); if (yadi) Jupiter, or else Venus or Mars (guruh shukrah athavaa bhaumah), is situated (vyavasthitah) in the ghna [8th, malefic-marker] house (ghne) -- [this conditional clause is completed by verse 17's result].

हिन्दी अर्थ

शुक्र (शुक्रे) सप्तम (अस्त) या अष्टम (निधन) भाव में हो, राहु (राहुः) बायें कान में अथवा (अथ) सिर पर (मस्तके) हो; यदि (यदि) गुरु, अथवा शुक्र या मंगल (गुरुः शुक्रोऽथवा भौमो) घ्न [अष्टम, मारक-सूचक] भाव में (घ्ने) स्थित हो (व्यवस्थितः) -- [यह शर्त-वाक्य श्लोक १७ के परिणाम-वाक्य से पूर्ण होता है]।

स्रोत: BPHS Ch.9, verse 16, continuing the "चिह्नज्ञान" (knowledge of bodily marks/moles) subsection from verses 14-15. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.101 (printed page 69). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p101-v16l1.png, scratchpad/bphs-p101-v16l2.png at 2x); the closing verse-number "॥ १६ ॥" and all words are clearly legible with no glyph-level ambiguity. Grammatical note: this verse is a conditional ("yadi...", "if...") clause with no explicit result within its own two lines; reading the immediately following verse 17 (scratchpad/bphs-p101-after-v16.png: "तदा चिह्नं भवेन्मूर्ध्नि ग्रहवर्णानुसारतः...", "then [tadaa] a mark occurs on the crown/head, according to the planet's color...") confirms that verse 16's conditions are completed by verse 17's "tadaa" (then) result clause -- i.e. the sentence spans the 16/17 verse-number boundary, a structure also seen between verses 12-13 and their surrounding commentary in this chapter. Verse 16 is therefore translated here as the conditional clause alone, without importing verse 17's result into this entry, to keep each verse's translation scoped to its own transcribed text. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तदा चिह्नं भवेन्मूर्ध्नि ग्रहवर्णानुसारतः । चन्द्रो वा क्षितिजो लग्नेऽथवा शुक्रो भवेद्यदि ॥ १७ ॥

tadaa chihnan bhavenmuurdhni grahavarnaanusaaratah | chandro vaa kshitijo lagne'thavaa shukro bhavedyadi || 17 ||

अंग्रेज़ी अर्थ

Then (tadaa) a mark (chihnam) occurs (bhavet) on the crown [of the head] (muurdhni), according to the planet's colour (graha-varna-anusaaratah) [completing verse 16's condition]. If (yadi) the Moon, or Mars [kshitija], is in the ascendant (lagne), or else (athavaa) it should be Venus (shukrah bhavet) [-- this new condition is completed by verse 18].

हिन्दी अर्थ

तब (तदा) मूर्धा [सिर के ऊपरी भाग] पर (मूर्ध्नि) ग्रह के वर्ण के अनुसार (ग्रहवर्णानुसारतः) चिह्न (चिह्नं) होता है (भवेत्) [श्लोक १६ की शर्त इससे पूर्ण होती है]। यदि (यदि) चन्द्रमा अथवा मंगल (क्षितिजः) लग्न में (लग्ने) हो, अथवा (अथवा) शुक्र हो (शुक्रो भवेत्) [-- यह नई शर्त श्लोक १८ से पूर्ण होती है]।

स्रोत: BPHS Ch.9, verse 17, continuing the "चिह्नज्ञान" subsection. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.101 (printed page 69). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p101-v17l1.png, scratchpad/bphs-p101-v17l2.png at 2x); the closing verse-number "॥ १७ ॥" and all words are clearly legible. "क्षितिजः" ("earth-born") is read as an epithet of Mars, per standard jyotish usage. Grammatical note, continuing the cross-verse-boundary sentence structure already disclosed for verse 16: line 1 ("tadaa chihnam bhavet muurdhni grahavarnaanusaaratah") is the "then" result-clause completing verse 16's "yadi" (if) condition; line 2 ("chandro vaa kshitijo lagne athavaa shukro bhavet yadi") opens a NEW "yadi" condition of its own, which is expected to be completed by verse 18's result clause (not yet transcribed). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्वादशाब्दे तदा चिह्नं शीर्षे स्यान्नात्र संशयः । त्रिकोणस्थार्किभौमाभ्यां गुदे लिङ्गेऽपि वा दिशेत् ॥ १८ ॥

dvaadashaabde tadaa chihnan shiirshe syaannaatra sanshayah | trikonasthaarkibhaumaabhyaan gude linge'pi vaa dishet || 18 ||

अंग्रेज़ी अर्थ

In the twelfth year (dvaadasha-abde), then (tadaa) a mark (chihnam) would be (syaat) on the head (shiirshe) -- there is no doubt about this (na atra sanshayah) [completing verse 17's condition]. By Saturn and Mars (arki-bhaumaabhyaam) [ark i = Saturn, son of the Sun] situated in trine houses (trikona-sthaabhyaam), [a mark] should be declared (dishet) on the anus, or also (api vaa) on the genital organ (gude linge).

हिन्दी अर्थ

बारहवें वर्ष में (द्वादशाब्दे) तब (तदा) सिर पर (शीर्षे) चिह्न (चिह्नं) होगा (स्यात्) -- इसमें सन्देह नहीं है (नात्र संशयः) [श्लोक १७ की शर्त इससे पूर्ण होती है]। त्रिकोण भावों में स्थित (त्रिकोणस्थाभ्यां) शनि और मंगल से (अर्किभौमाभ्यां) [अर्कि = सूर्यपुत्र शनि], गुदा में या (गुदे) लिंग में भी (लिङ्गेऽपि वा) चिह्न कहना चाहिए (दिशेत्)।

स्रोत: BPHS Ch.9, verse 18, continuing/closing the "चिह्नज्ञान" subsection's cross-verse conditional begun in verse 17 (line 1 here is the "tadaa" result completing verse 17's "yadi chandro vaa kshitijo lagne..." condition), then stating an independent rule in line 2. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.101 (printed page 69). Read from the standard 600dpi full-page render and a combined zoom crop (scratchpad/bphs-p101-after-v17.png at 1.5x); the closing verse-number "॥ १८ ॥" and all words are clearly legible with no glyph-level ambiguity. "अर्किः" ("son of Arka/the Sun") is read as an epithet of Saturn, per standard jyotish usage, paralleling "क्षितिजः" for Mars used in verse 17. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुखे लग्नेऽथवा मन्दस्त्रिकोणे भार्गवो यदि । मृत्युस्थौ बुधदेवेज्यौ जठरौ तत् समादिशेत् ॥ १९ ॥

sukhe lagne'thavaa mandastrikone bhaargavo yadi | mrityusthau budhadevejyau jatharau tat samaadishet || 19 ||

अंग्रेज़ी अर्थ

If (yadi) Venus (bhaargavah) [is] in the 4th house (sukhe), the ascendant (lagne), or else (athavaa) in Saturn's trine (manda-trikone) [-- a mark accordingly]. Mercury and Jupiter (budha-devejyau), the two (dvau) situated in the 8th [death] house (mrityusthau), [indicate a mark] on the belly (jatharau) -- that (tat) should be so declared (samaadishet).

हिन्दी अर्थ

यदि (यदि) शुक्र (भार्गवो) चतुर्थ भाव (सुखे), लग्न (लग्ने), अथवा (अथवा) शनि की त्रिकोण राशि में (मन्दस्त्रिकोणे) हो [-- तदनुसार चिह्न]। अष्टम [मृत्यु] भाव में स्थित (मृत्युस्थौ) बुध और बृहस्पति (बुधदेवेज्यौ) दोनों [होने पर] उदर पर (जठरौ) [चिह्न बताया जाए] -- ऐसा (तत्) कहना चाहिए (समादिशेत्)।

स्रोत: BPHS Ch.9, verse 19, continuing the "चिह्नज्ञान" subsection. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.101 (printed page 69). Read from the standard 600dpi full-page render and a combined zoom crop covering the page's bottom section (scratchpad/bphs-p101-bottom.png, unscaled, i.e. 1x); the closing verse-number "॥ १९ ॥" and all words are clearly legible with no glyph-level ambiguity, prior to any further zoom attempts. "भार्गवः" ("descendant of Bhrigu") is read as Venus and "देवेज्यः"/"देव-इज्यः" ("preceptor of the gods") as Jupiter, both standard jyotish epithets. Line 1's condition ("yadi bhaargavah sukhe lagne athavaa manda-trikone") does not carry an explicit result within this verse's own two lines (its result may be implicit or elliptical, consistent with the terse, list-like style already seen in verses 16-18 of this subsection); line 2 ("mrityusthau budhadevejyau jatharau tat samaadishet") is a separate, self-contained rule about Mercury and Jupiter in the 8th house indicating a belly-mark. Both are transcribed and translated as printed, without forcing an invented explicit result onto line 1. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुक्रार्कग्रहवश्चेत् स्युः सुखे लग्नेऽथवा कुजे । तदा चिह्नं भवेन्नूनं वामपादे विशेषतः ॥ २० ॥

shukraarkagrahavashchet syuh sukhe lagne'thavaa kuje | tadaa chihnan bhavennuunan vaamapaade visheshatah || 20 ||

अंग्रेज़ी अर्थ

If (chet) the planets (grahaah) Venus and Sun (shukra-arka-) happen to be (syuh) in the 4th house (sukhe), the ascendant (lagne), or else (athavaa) with Mars (kuje), then (tadaa) a mark (chihnam) would certainly (nuunam) be, especially (visheshatah), on the left foot (vaama-paade).

हिन्दी अर्थ

यदि (चेत्) शुक्र और सूर्य (शुक्रार्क-) ग्रह (ग्रहाः) चतुर्थ भाव में (सुखे), लग्न में (लग्ने), अथवा (अथवा) मंगल के साथ (कुजे) हों (स्युः), तब (तदा) निश्चय ही (नूनं) विशेष रूप से (विशेषतः) बायें पैर पर (वामपादे) चिह्न (चिह्नं) होगा (भवेत्)।

स्रोत: BPHS Ch.9, verse 20, continuing the "चिह्नज्ञान" subsection; a self-contained chet...tadaa (if...then) rule. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). Line 1 falls on PDF p.101 (printed page 69), in the very bottom margin where the eGangotri digitization watermark ("CC-0. Swami Atmanand Giri (Prabhuji). Veda Nidhi Varanasi. Digitized by eGangotri") runs beneath the line -- the watermark touches only the lower edge of the glyphs' visual field without obscuring their distinguishing upper strokes, so the line remains legible (scratchpad/bphs-p101-v20l1-real2.png at 2x); line 2 and the closing verse-number "॥ २० ॥" fall cleanly at the top of the next PDF page, p.102 (printed page 70, confirmed via the visible page-top title "बृहत्पाराशरहोराशास्त्रम्" and page number "७०", scratchpad/bphs-p102-top.png), read from scratchpad/bphs-p102-v20.png. One compound in line 1 has a residual reading ambiguity: "ग्रहवः" appears to carry a "व" rather than the expected "ा" of "ग्रहाः" ("planets", nominative plural, which would be the grammatically expected form here); transcribed as printed ("ग्रहवश्चेत्") per zero-fabrication discipline, translated per the grammatically sensible reading "ग्रहाः" with the discrepancy disclosed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुक्रो लग्नेऽष्टमे राहुश्चिह्नं वामश्रुतौ शिशोः । जीवो लग्ने मदे राहुस्तदा वामभुजे वदेत् ॥ २१ ॥

shukro lagne'shtame raahushchihnan vaamashrutau shishoh | jiivo lagne made raahustadaa vaamabhuje vadet || 21 ||

अंग्रेज़ी अर्थ

Venus (shukrah) [being] in the ascendant or the 8th house (lagne ashtame), Rahu (raahuh) [gives] a mark (chihnam) on the left ear (vaama-shrutau) of the child (shishoh). Jupiter (jiivah) [being] in the ascendant (lagne), [and] Rahu (raahuh) in [a house denoted "made" -- see note], then (tadaa) [a mark] should be declared (vadet) on the left arm (vaama-bhuje).

हिन्दी अर्थ

शुक्र (शुक्रो) लग्न या अष्टम भाव में (लग्नेऽष्टमे) हो, [और] राहु हो, तो शिशु (शिशोः) के बायें कान पर (वामश्रुतौ) चिह्न (चिह्नं) होता है। गुरु (जीवो) लग्न में (लग्ने) हो, [और] राहु ["मदे" नामक भाव में -- टिप्पणी देखें] हो, तब (तदा) बायीं भुजा पर (वामभुजे) [चिह्न] कहना चाहिए (वदेत्)।

स्रोत: BPHS Ch.9, verse 21, continuing the "चिह्नज्ञान" subsection, self-contained within its own two lines. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.102 (printed page 70, confirmed via the visible page-top title "बृहत्पाराशरहोराशास्त्रम्" and page number "७०", scratchpad/bphs-p102-top.png). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p102-v21.png, scratchpad/bphs-p102-v21l2.png at 2x); the closing verse-number "॥ २१ ॥" and most words are clearly legible. One word's house-reference is uncertain: "मदे" (locative of "mada") does not correspond to a house name recognized from the standard jyotish bhava vocabulary used elsewhere in this chapter (lagna, sukha, ashtama, trikona, etc.); it is transcribed exactly as printed per zero-fabrication discipline, and translated by leaving the specific house denoted unresolved rather than guessing, since no corroborating commentary was found for this verse. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अष्टमे रजनीनाथो-व्ययस्थौ गुरुभार्गवौ । मदस्थौ मन्दमाहेयौ तदा चिह्नं भुजद्वये ॥ २२ ॥

ashtame rajaniinaatho-vyayasthau gurubhaargavau | madasthau mandamaaheyau tadaa chihnan bhujadvaye || 22 ||

अंग्रेज़ी अर्थ

[With] the Moon (rajanii-naathah, "lord of the night") in the 8th house (ashtame) [and] situated in the 12th (vyaya-sthau) [together with] Jupiter and Venus (guru-bhaargavau); [and with] Saturn and Mars (manda-maaheyau) [maaheya, "son of the Earth", an epithet of Mars] situated in the house called mada (mada-sthau) -- then (tadaa) a mark (chihnam) [occurs] on both arms (bhuja-dvaye).

हिन्दी अर्थ

अष्टम भाव में (अष्टमे) चन्द्रमा (रजनीनाथः) [और] द्वादश भाव में स्थित (व्ययस्थौ) गुरु और शुक्र (गुरुभार्गवौ); [तथा] "मद" नामक भाव में स्थित (मदस्थौ) शनि और मंगल (मन्दमाहेयौ) [माहेय = मंगल का एक नाम] -- तब (तदा) दोनों भुजाओं पर (भुजद्वये) चिह्न (चिह्नं) होता है।

स्रोत: BPHS Ch.9, verse 22, continuing the "चिह्नज्ञान" subsection, and using "मद" (mada) as a house-locative term for the second time in this chapter (compare verse 21's "मदे", flagged there as an unresolved house-name). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.102 (printed page 70). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p102-v22l1.png, scratchpad/bphs-p102-v22l2.png at 2x); the closing verse-number "॥ २२ ॥" and all individual words -- including a hyphen printed between "रजनीनाथो" and "व्ययस्थौ" (scratchpad/bphs-p102-v22l1.png) -- are clearly legible with no glyph-level ambiguity. "रजनीनाथः" ("lord of the night") is read as the Moon and "माहेयः" ("son of the Earth") as Mars, both standard jyotish epithets, paralleling "क्षितिजः" for Mars used in verse 17. This recurrence of "मद" as a house term (now twice) suggests it is a genuine, if unusual, bhava-designation used by this text rather than a one-off misprint, though its exact identity among the twelve houses remains unconfirmed absent corroborating commentary. Grammatical note: the precise distribution of the dual-form subjects ("gurubhaargavau", "mandamaaheyau") across the three locative phrases (ashtame, vyayasthau, madasthau) is not fully certain from the compressed shloka syntax alone; the translation above renders the most grammatically plausible pairing (Moon in the 8th; Jupiter-Venus in the 12th; Saturn-Mars in mada) without asserting full certainty, per the disclosure-without-forced-resolution technique. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुक्रो धनेऽथ कर्मस्थौ सैंहिकेयशनैश्चरौ । अष्टमे दिवसाधीशो नाभौ चिह्नं तदा दिशेत् ॥ २३ ॥

shukro dhane'tha karmasthau sainhikeyashanaishcharau | ashtame divasaadhiisho naabhau chihnan tadaa dishet || 23 ||

अंग्रेज़ी अर्थ

Venus (shukrah) [being] in the 2nd house (dhane), or else (atha) Rahu and Saturn (sainhikeya-shanaishcharau) [being] in the 10th house (karma-sthau); [and] the Sun (divasa-adhiishah, "lord of the day") [being] in the 8th house (ashtame) -- then (tadaa) a mark (chihnam) should be indicated (dishet) on the navel (naabhau).

हिन्दी अर्थ

शुक्र (शुक्रो) द्वितीय भाव में (धने), अथवा (अथ) राहु और शनि (सैंहिकेयशनैश्चरौ) दशम भाव में (कर्मस्थौ) हों; [तथा] सूर्य (दिवसाधीशः, "दिन का स्वामी") अष्टम भाव में (अष्टमे) हो -- तब (तदा) नाभि पर (नाभौ) चिह्न (चिह्नं) कहना चाहिए (दिशेत्)।

स्रोत: BPHS Ch.9, verse 23, continuing the "चिह्नज्ञान" subsection, self-contained within its own two lines. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.102 (printed page 70). Read from the standard 600dpi full-page render and a combined zoom crop (scratchpad/bphs-p102-v23area.png, unscaled); the closing verse-number "॥ २३ ॥" and all words are clearly legible with no glyph-level ambiguity. "सैंहिकेयः" ("son of Simhika") is read as Rahu, "शनैश्चरः" ("slow-mover") as Saturn, and "दिवसाधीशः" ("lord of the day") as the Sun, all standard jyotish epithets. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुक्रभौमौ तृतीयस्थौ द्वितीये रजनीपतिः । दशमभवने मन्दाच्चिह्नं कटिगतं भवेत् ॥ २४ ॥

shukrabhaumau tritiiyasthau dvitiiye rajaniipatih | dashamabhavane mandaachchihnan katigatan bhavet || 24 ||

अंग्रेज़ी अर्थ

Venus and Mars, the two (shukra-bhaumau), [being] situated in the 3rd house (tritiiya-sthau); the Moon (rajanii-patih, "lord of the night") [being] in the 2nd (dvitiiye). In the 10th house (dashama-bhavane), a mark from Saturn (mandaat chihnam, sandhied mandaachchihnam) would be (bhavet) located at the waist (kati-gatam).

हिन्दी अर्थ

शुक्र और मंगल, दोनों (शुक्रभौमौ), तृतीय भाव में स्थित (तृतीयस्थौ) हों; चन्द्रमा (रजनीपतिः, "रात्रि का स्वामी") द्वितीय भाव में (द्वितीये) हो। दशम भाव में (दशमभवने) शनि से चिह्न (मन्दाच्चिह्नं, संधि: मन्दात् + चिह्नं) कटि पर स्थित (कटिगतं) होगा (भवेत्)।

स्रोत: BPHS Ch.9, verse 24, continuing the "चिह्नज्ञान" subsection, self-contained within its own two lines. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.102 (printed page 70). CORRECTED reading of line 2 after further zoom crops at 3.5x-5x (scratchpad/bphs-p102-v24-mandaword-3.png, scratchpad/bphs-p102-v24-katiword2.png), superseding this verse's initial seed which had misread the line-2 house-term as "अवने" and the closing phrase as "कटिस्थं": the correct reading is "दशमभवने" ("in the 10th house", using "bhavana" = "house/mansion" as the bhava-word rather than the terser "dashame") and "कटिगतं" ("located at the waist", kati + gata). The compound "मन्दाच्चिह्नं" is read as "मन्दात् चिह्नं" ("a mark from/of Saturn") joined by the standard त्+च् sandhi rule (which doubles the च); a residual glyph-level ambiguity remains between this reading's "च्च" and an alternate "श्च" shape in the worn print, but "मन्दात् चिह्नं" is preferred as the grammatically sensible resolution over a non-existent "मन्दाश्चिह्न". "रजनीपतिः" ("lord of the night") is read as the Moon, a standard jyotish epithet paralleling "रजनीनाथः" used identically in verse 22. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रिषडाये यदा सौम्यो व्यये वाचस्पतिर्भवेत् । सहजे च भवेत् काव्यस्तदा चिह्नं हृदि स्थितम् ॥ २५ ॥

trishadaaye yadaa saumyo vyaye vaachaspatirbhavet | sahaje cha bhavet kaavyastadaa chihnan hridi sthitam || 25 ||

अंग्रेज़ी अर्थ

When (yadaa) Mercury (saumyah, "son of Soma [the Moon]") [is] in the 3rd/6th house (trisha-daaye) [and] Jupiter (vaachaspatih, "lord of speech") [is] in the 12th (vyaye); and (cha) when Venus (kaavyah, "the poet") would be (bhavet) in the 3rd house (sahaje) -- then (tadaa) a mark (chihnam) would be situated (sthitam) on the heart (hridi).

हिन्दी अर्थ

जब (यदा) बुध (सौम्यो, "सोम [चन्द्रमा] का पुत्र") तृतीय/षष्ठ भाव में (त्रिषडाये) [और] बृहस्पति (वाचस्पतिः, "वाणी का स्वामी") द्वादश भाव में (व्यये) हो; और (च) जब शुक्र (काव्यः, "कवि") तृतीय भाव में (सहजे) हो (भवेत्) -- तब (तदा) हृदय पर (हृदि) चिह्न (चिह्नं) स्थित (स्थितम्) होगा।

स्रोत: BPHS Ch.9, verse 25, continuing the "चिह्नज्ञान" subsection, self-contained within its own two lines. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.102 (printed page 70). Read from the standard 600dpi full-page render and combined zoom crops (scratchpad/bphs-p102-v25-full.png, scratchpad/bphs-p102-v25-l2.png, at 1.3x); the closing verse-number "॥ २५ ॥" and all words are clearly legible with no glyph-level ambiguity. "सौम्यः" ("son of Soma") is read as Mercury, "वाचस्पतिः" ("lord of speech") as Jupiter, and "काव्यः" ("the poet", an epithet of Shukracharya) as Venus, all standard jyotish epithets; "सहजे" ("[house of] the co-born", i.e. siblings) and "त्रिषडाये" (a compound of 3rd and 6th) are the standard terms for the 3rd and 3rd/6th houses respectively. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पिता के परोक्ष में जन्म ज्ञान-- लग्ने मन्दो मदे भौमश्चन्द्रो लग्नं न पश्यति । बुधशुक्रान्तरे चन्द्रः परोक्षे स्याज्जनिः पितुः ॥ २६ ॥

pitaa ke paroksh men janma jnaan-- lagne mando made bhaumashchandro lagnan na pashyati | budhashukraantare chandrah paroksheh syaajjanih pituh || 26 ||

अंग्रेज़ी अर्थ

[Subsection:] Knowledge of birth in the father's absence -- If Saturn (mandah) [is] in the ascendant (lagne), Mars (bhaumah) [is] in the [house called] mada (made), [and] the Moon (chandrah) does not aspect (na pashyati) the ascendant (lagnam); [and if] the Moon (chandrah) [is] between Mercury and Venus (budha-shukra-antare) -- then (syaat) the child's birth (janih) would be (syaat) in the father's (pituh) absence (parokshe).

हिन्दी अर्थ

[उपशीर्षक:] पिता के परोक्ष में जन्म ज्ञान -- यदि शनि (मन्दो) लग्न में (लग्ने) हो, मंगल (भौमः) "मद" नामक भाव में (मदे) हो, [और] चन्द्रमा (चन्द्रो) लग्न को (लग्नं) न देखता हो (न पश्यति); [और] चन्द्रमा बुध और शुक्र के बीच (बुधशुक्रान्तरे) हो -- तो (स्यात्) सन्तान का जन्म (जनिः) पिता के (पितुः) परोक्ष में (परोक्षे) होगा।

स्रोत: BPHS Ch.9, verse 26, opening a new subsection ("पिता के परोक्ष में जन्म ज्ञान", "knowledge of birth in the father's absence") after the "चिह्नज्ञान" subsection's closing commentary block (marked "१४-२५" at the bottom of PDF p.102). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.103 (printed page 71, confirmed via the visible page-top running title "सूतिकाध्यायः", i.e. the chapter's own title -- "the chapter on childbirth/confinement" -- and page number "७१", scratchpad/bphs-p103-top.png). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p103-v26.png, scratchpad/bphs-p103-v26l2.png, at 1.3x); the closing verse-number "॥ २६ ॥" and all words are clearly legible with no glyph-level ambiguity. The house-term "मदे" (locative of "mada") recurs here for a third time in this chapter (compare verses 21 and 22), reinforcing that it is an intentional bhava-designation used by this text, though its exact identity among the twelve houses remains unconfirmed absent corroborating commentary -- unlike the immediately preceding commentary block (PDF p.102, marked "१४-२५"), which is Devchandra Jha's Hindi prose and is excluded from transcription per copyright-safety discipline (it also embeds an uncredited quotation from Varahamihira's Brihajjataka, likewise excluded). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अष्टमे नवमे वापि चरभे यदि भास्करः । परोक्षे जन्म जातस्य पितुः स्यान्नात्र संशयः ॥ २७ ॥

ashtame navame vaapi charabhe yadi bhaaskarah | parokshe janma jaatasya pituh syaannaatra sanshayah || 27 ||

अंग्रेज़ी अर्थ

If (yadi) the Sun (bhaaskarah) [is] in a movable sign (chara-bhe) situated in the 8th or the 9th house (ashtame navame vaapi) -- the birth (janma) of the child (jaatasya) would be (syaat) in the father's (pituh) absence (parokshe); there is no doubt (na atra sanshayah) about this.

हिन्दी अर्थ

यदि (यदि) सूर्य (भास्करः) अष्टम या नवम भाव में (अष्टमे नवमे वापि) चर राशि में (चरभे) हो -- तो सन्तान का (जातस्य) जन्म (जन्म) पिता के (पितुः) परोक्ष में (परोक्षे) होगा (स्यात्); इसमें (अत्र) कोई सन्देह (संशयः) नहीं (न) है।

स्रोत: BPHS Ch.9, verse 27, continuing the "पिता के परोक्ष में जन्म ज्ञान" subsection begun at verse 26, self-contained within its own two lines. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.103 (printed page 71). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p103-v27-28b.png, scratchpad/bphs-p103-v27l2-zoom2.png at 4x); the closing verse-number "॥ २७ ॥" and all words are clearly legible. The conjunct in "स्यान्नात्र" (dental n-n, from sandhi of स्यात् + न) closely resembles the visually similar doubled-consonant ligatures seen elsewhere in this chapter (e.g. verse 24's "मन्दाच्चिह्नं"), but resolves unambiguously here as "na atra" ("not here", i.e. "no doubt about this") given the sentence's plain sense. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कर्मभावं विना दृश्ये चरभे यदि भास्करः । लग्नं चन्द्रो न पश्येच्चेद् दूरसंस्थः शिशोः पिता ॥ २८ ॥

karmabhaavan vinaa drishye charabhe yadi bhaaskarah | lagnan chandro na pashyechched duurasansthah shishoh pitaa || 28 ||

अंग्रेज़ी अर्थ

If (yadi) the Sun (bhaaskarah) [is] visible (drishye) in a movable sign (chara-bhe) other than (vinaa) the 10th house/house of action (karma-bhaavam), [and] if (ched) the Moon (chandrah) does not aspect (na pashyet) the ascendant (lagnam) -- [then] the child's (shishoh) father (pitaa) is far away (duura-sansthah) [at the time of birth].

हिन्दी अर्थ

यदि (यदि) सूर्य (भास्करः) दशम/कर्म भाव को (कर्मभावं) छोड़कर (विना) किसी अन्य चर राशि में (चरभे) दिखाई दे (दृश्ये), [और] यदि (चेत्) चन्द्रमा (चन्द्रो) लग्न को (लग्नं) न देखे (न पश्येत्) -- तो सन्तान का (शिशोः) पिता (पिता) दूर स्थित (दूरसंस्थः) होगा [जन्म के समय]।

स्रोत: BPHS Ch.9, verse 28, closing the "पिता के परोक्ष में जन्म ज्ञान" subsection begun at verse 26, self-contained within its own two lines; immediately followed by a Hindi commentary block (Devchandra Jha, explicitly marked "२६-२८" at its close and quoting Varahamihira by name) which is excluded from transcription per copyright-safety discipline. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.103 (printed page 71). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p103-v28.png, scratchpad/bphs-p103-v28l2b-left.png, -right.png at 2x); the closing verse-number "॥ २८ ॥" and all words are clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पितृ-सौख्यहानिकर योग-- रात्रौ जन्म यदा यस्य, भौमयुक्तः शनैश्वरः । चरस्थः परदेशे तु तातस्य निधनं वदेत् ॥ २९ ॥

pitri-saukhyahaanikar yoga-- raatrau janma yadaa yasya, bhaumayuktah shanaishvarah | charasthah paradeshe tu taatasya nidhanan vadet || 29 ||

अंग्रेज़ी अर्थ

[Subsection:] The yoga harming the father's well-being -- When (yadaa) someone's (yasya) birth (janma) [is] at night (raatrau), [and] Saturn (shanaishvarah) joined with Mars (bhauma-yuktah) is situated in a movable sign (chara-sthah) -- one should declare (vadet) the death (nidhanam) of the father (taatasya) [to occur] in a foreign land (paradeshe tu).

हिन्दी अर्थ

[उपशीर्षक:] पितृ-सौख्यहानिकर योग -- जब (यदा) किसी का (यस्य) जन्म (जन्म) रात्रि में (रात्रौ) हो, [और] शनि (शनैश्वरः) मंगल से युक्त (भौमयुक्तः) चर राशि में स्थित (चरस्थः) हो -- तो पिता (तातस्य) की मृत्यु (निधनं) परदेश में (परदेशे तु) कहनी चाहिए (वदेत्)।

स्रोत: BPHS Ch.9, verse 29, opening a new subsection ("पितृ-सौख्यहानिकर योग", "the yoga causing loss of the father's well-being") after the "पिता के परोक्ष में जन्म ज्ञान" subsection's closing commentary block (marked "२६-२८" at the bottom of the same page). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.103 (printed page 71). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p103-v29c.png, -v29d.png, -v29-word2.png at 3x); the subsection heading and all words are clearly legible. Saturn's epithet is printed here as "शनैश्वरः" (shanaishvarah, with a श्व conjunct) rather than the more standard "शनैश्चरः" (shanaishcharah, with श्च) found elsewhere in this text (e.g. Ch.9 v.24's "मन्दः"/"मन्दात्"); transcribed exactly as printed per zero-fabrication discipline, read as Saturn regardless given the unmistakable shared root ("shanaih", "slowly") and verse context. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अष्टमे वा व्यये पापा लग्नेशो बलसंयुतः । सुखेऽथ नवमे वापि रोगयुक्तस्तदा पिता ॥ ३० ॥

ashtame vaa vyaye paapaa lagnesho balasanyutah | sukhe'tha navame vaapi rogayuktastadaa pitaa || 30 ||

अंग्रेज़ी अर्थ

If the lord of the ascendant (lagneshah), being malefic (paapah) and endowed with strength (bala-sanyutah), [is] in the 8th or 12th house (ashtame vaa vyaye); and also (atha) in the 4th or 9th house (sukhe navame vaapi) -- then (tadaa) the father (pitaa) becomes afflicted with disease (roga-yuktah).

हिन्दी अर्थ

यदि लग्नेश (लग्नेशो) पापी (पापा) होकर बलयुक्त (बलसंयुतः) अष्टम या द्वादश भाव में (अष्टमे वा व्यये) हो; और साथ ही (अथ) चतुर्थ या नवम भाव में (सुखे नवमे वापि) [भी ऐसा योग बने] -- तो (तदा) पिता (पिता) रोगयुक्त (रोगयुक्तः) हो जाएगा।

स्रोत: BPHS Ch.9, verse 30, continuing the "पितृ-सौख्यहानिकर योग" subsection begun at verse 29, self-contained within its own two lines. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.103 (printed page 71). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p103-v30.png, scratchpad/bphs-p103-v30-papa.png, scratchpad/bphs-p103-v30l2word.png at 3x); the closing verse-number "॥ ३० ॥" and most words are clearly legible. Line 1's third word is printed as "पापा" (ending in the long vowel आ) rather than the grammatically expected "पापो" (nominative masculine, agreeing with "लग्नेशो"); transcribed exactly as printed per zero-fabrication discipline, translated as "malefic" per the plainly intended sense despite this residual case-ending ambiguity, which may be a print/scan artifact (the ो and ा vowel signs can look similar at this resolution) rather than a genuine textual variant. "सुखे" ("[house of] happiness") is the standard term for the 4th house. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नस्थं सवलं सूर्यं शनिभौमौ प्रपश्यतः । जन्मकाले तदा तस्य रोगयुक्तः पिता भवेत् ॥ ३१ ॥

lagnasthan savalan suuryan shanibhaumau prapashyatah | janmakaale tadaa tasya rogayuktah pitaa bhavet || 31 ||

अंग्रेज़ी अर्थ

If Saturn and Mars (shani-bhaumau), the two, aspect (prapashyatah) the strong Sun (sa-balam suryam) situated in the ascendant (lagna-stham) -- at the time of birth (janma-kaale), then (tadaa) his (tasya) father (pitaa) would become (bhavet) afflicted with disease (roga-yuktah).

हिन्दी अर्थ

यदि शनि और मंगल (शनिभौमौ), दोनों, लग्न में स्थित (लग्नस्थं) बलवान सूर्य (सवलं सूर्यं) को देखते हों (प्रपश्यतः) -- तो जन्म के समय (जन्मकाले) उसके (तस्य) पिता (पिता) रोगयुक्त (रोगयुक्तः) हो जाएंगे (भवेत्)।

स्रोत: BPHS Ch.9, verse 31, continuing the "पितृ-सौख्यहानिकर योग" subsection begun at verse 29, self-contained within its own two lines. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.103 (printed page 71). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p103-v31.png, scratchpad/bphs-p103-v31l2-left.png, -right.png at 2x); the closing verse-number "॥ ३१ ॥" and all words are clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुर्थे दशमे वापि शनिभौमार्कखेचराः । शुभसम्बन्धहीनाश्चेत्तदा पितृसुखं नहि ॥ ३२ ॥ इति सविमर्शे-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे सूतिकाध्यायः समाप्तः ॥ ९ ॥

chaturthe dashame vaapi shanibhaumaarkakhecharaah | shubhasambandhahiinaashchettadaa pitrisukhan nahi || 32 || iti savimarshe-sudhaavyaakhyopete brihatpaaraasharahoraashaastre suutikaadhyaayah samaaptah || 9 ||

अंग्रेज़ी अर्थ

If Saturn, Mars, the Sun and [other] planets (shani-bhauma-arka-khecharaah, "sky-movers") [are] in the 4th or 10th house (chaturthe dashame vaapi), devoid of an auspicious connection (shubha-sambandha-hiinaah) -- then (tadaa) there is no happiness from the father (pitri-sukham nahi). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion (savimarshe-sudhaa-vyaakhya), the Sutika chapter (sutikaadhyaayah) is concluded (samaaptah). Chapter 9.

हिन्दी अर्थ

यदि शनि, मंगल, सूर्य और [अन्य] ग्रह (शनिभौमार्कखेचराः) चतुर्थ या दशम भाव में (चतुर्थे दशमे वापि) हों, [और] शुभ सम्बन्ध से रहित (शुभसम्बन्धहीनाः) हों -- तो (तदा) पिता से सुख (पितृसुखं) नहीं (नहि) मिलता। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में सूतिकाध्याय (सूतिकाध्यायः) समाप्त (समाप्तः) होता है। अध्याय ९।

स्रोत: BPHS Ch.9, verse 32, closing the "पितृ-सौख्यहानिकर योग" subsection begun at verse 29, self-contained within its own two lines; followed by a Hindi commentary block (Devchandra Jha) paraphrasing verses 29-32, excluded from transcription per copyright-safety discipline. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.103 (printed page 71). Read from the standard 600dpi full-page render and zoom crops (scratchpad/bphs-p103-v32.png, scratchpad/bphs-p103-v32l2-left.png, -right.png at 2x); the closing verse-number "॥ ३२ ॥" and all words are clearly legible with no glyph-level ambiguity. "खेचराः" ("sky-movers") is the standard generic term for planets. English/Hindi meanings by Vedic Hora -- for review. Chapter 9's closing colophon ("इति सविमर्शे-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे सूतिकाध्यायः समाप्तः ॥ ९ ॥") is appended to this verse per the same convention used for chapter-opening titles (cf. verse 9.1's prefixed "अथ सूतिकाध्यायः ॥ ९ ॥"); read from PDF p.104 (printed page 72), scratchpad/bphs-p104-colophon2.png and -colophon3-mid.png, confirming the immediately preceding commentary line's closing marker "॥२९-३२॥" (verses 29-32) and the colophon naming this chapter "सूतिकाध्यायः" ("Sutika-adhyaya", the chapter on childbirth/postnatal matters) and the editor's commentary title "सविमर्श-सुधा-व्याख्या" ("Sudha commentary, with discussion"). This confirms Chapter 9 is complete at 32 verses.

संस्कृत

अथाऽरिष्टविवेचनाध्यायः ॥ १० ॥ पराशर उवाच-- मैत्रेयादौ जनुर्लग्नाद्रिष्टं तद्भङ्गमेव च । विचार्य तदनु ब्रूयात् फलं तन्वादिभावजम् ॥ १ ॥

athaa'rishtavivechanaadhyaayah || 10 || paraashara uvaacha-- maitreyaadau janurlagnaadrishtan tadbhangameva cha | vichaarya tadanu bruuyaat phalan tanvaadibhaavajam || 1 ||

अंग्रेज़ी अर्थ

[Chapter 10: The chapter discerning danger to life.] Parashara said -- O Maitreya (maitreya), first (aadau), from the birth-ascendant (janu-lagnaat), one should examine (vichaarya) danger to life (rishtam) and its cancellation (tad-bhangam eva cha); after that (tadanu), one should declare (bruuyaat) the results (phalam) arising from the 1st house and other houses (tanva-aadi-bhaava-jam).

हिन्दी अर्थ

[अध्याय १०: अरिष्ट-विवेचन अध्याय।] पराशर ने कहा -- हे मैत्रेय (मैत्रेय), पहले (आदौ), जन्म-लग्न से (जनुर्लग्नात्) आयु को हानि (रिष्टं) और उसके भंग (तद्भङ्गम्) का विचार करना चाहिए (विचार्य); उसके बाद (तदनु), तनु आदि भावों से उत्पन्न (तन्वादिभावजम्) फल (फलं) कहना चाहिए (ब्रूयात्)।

स्रोत: BPHS Chapter 10 opening: title "अथाऽरिष्टविवेचनाध्यायः ॥ १० ॥" ("the chapter discerning danger [to life]"), invocation "पराशर उवाच--", and verse 1, prefixed per the established chapter-opening convention (cf. verse 9.1). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.104 (printed page 72). Read from the standard 600dpi full-page render, a 4x-downsampled overview, and zoom crops (scratchpad/bphs-p104-ch10title.png, -ch10title-zoom.png confirming the avagraha in "अथाऽरिष्ट", scratchpad/bphs-p104-v1.png). The fourth word was initially misread from the overview as "तद्भावादिभावजम्" but on zoom clearly reads "तन्वादिभावजम्"; this is independently corroborated by the immediately following (untranscribed) Hindi commentary paragraph by editor Devchandra Jha, which paraphrases the verse using the identical term "तन्वादि भावों" (excluded from transcription per copyright-safety discipline; read only as corroborating context). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुर्विंशतिवर्षाणि यावद् गच्छति जन्मतः । जन्मारिष्टं तु तावत् स्यादायुर्दायं न चिन्तयेत् ॥ २ ॥

chaturvinshativarshaani yaavad gacchati janmatah | janmaarishtan tu taavat syaadaayurdaayan na chintayet || 2 ||

अंग्रेज़ी अर्थ

For as long as (yaavat) twenty-four years (chatur-vinshati-varshaani) pass (gacchati) from birth (janmatah), for that long (taavat) there is (syaat) danger to the newborn's life (janma-arishtam); [therefore] one should not [yet] calculate (na chintayet) the allotment of longevity (aayuh-daayam).

हिन्दी अर्थ

जब तक (यावत्) जन्म से (जन्मतः) चौबीस वर्ष (चतुर्विंशतिवर्षाणि) बीतते हैं (गच्छति), तब तक (तावत्) बाल्यावस्था में मृत्यु का भय (जन्मारिष्टं) रहता है (स्यात्); [अतः] आयु के दाय (आयुर्दायं) का विचार (चिन्तयेत्) [अभी] नहीं करना चाहिए (न)।

स्रोत: BPHS Ch.10, verse 2, continuing directly after verse 1's method-statement. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.104 (printed page 72). Line 1 read from scratchpad/bphs-p104-v2b.png (clearly legible, no ambiguity). Line 2 read from scratchpad/bphs-p104-v2l2-left.png/-right.png and cross-checked with a dedicated zoom crop (scratchpad/bphs-p104-v2-word.png, 3x) targeting its third word: an initial reading suggested "आयुर्दैर्यं" ("length of life", from aayus+dairghya), but the confirming zoom crop shows no ऐ-matra on the relevant syllable, instead showing आ + या -- read as "आयुर्दायं" ("the allotment/portion of longevity", aayus+daaya), which is also the more standard compound in this jyotish context (cf. the technical term "aayurdaaya" for longevity calculation) and fits the verse's sense (postponing the longevity calculation until after the risk of childhood/infant death, "bala-arishta", has passed) -- corroborated by the adjacent (untranscribed) Hindi commentary's use of the term "बालारिष्ट" for this same span. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अरिष्टयोग-- षष्ठाष्टरिष्फगश्चन्द्रो ग्रहैः क्रूरैश्च वीक्षितः । जातस्य मृत्युदः सद्यस्त्वष्टवर्षैः शुभेक्षितः ॥ ३ ॥

arishtayoga-- shashthaashtarishphagashchandro grahaih kruraishcha viikshitah | jaatasya mrityudah sadyastvashtavarshaih shubhekshitah || 3 ||

अंग्रेज़ी अर्थ

[Subsection:] The yoga of danger [to infant life] -- If the Moon (chandrah), situated in the 6th, 8th, or 12th house (shashtha-ashta-rishpha-gah), is aspected by malefic planets (grahaih kruraih cha viikshitah), it causes immediate death (sadyah mrityudah) to the newborn (jaatasya); [but] if aspected by benefics (shubha-iikshitah), [the danger extends only] up to eight years (ashta-varshaih).

हिन्दी अर्थ

[उपशीर्षक:] अरिष्ट योग -- यदि चन्द्रमा (चन्द्रः) छठे, आठवें या बारहवें भाव में स्थित होकर (षष्ठाष्टरिष्फगः) पाप ग्रहों द्वारा देखा जाए (ग्रहैः क्रूरैश्च वीक्षितः), तो नवजात शिशु की (जातस्य) तुरंत मृत्यु (सद्यः मृत्युदः) होती है; [परन्तु] यदि शुभ ग्रहों द्वारा देखा जाए (शुभेक्षितः), तो [यह भय] आठ वर्षों तक (अष्टवर्षैः) [ही] रहता है।

स्रोत: BPHS Ch.10, verse 3, opening a new subsection headed "अरिष्टयोग--" ("the yoga of danger [to life]"), immediately after verse 2. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.104 (printed page 72). Read from a 4x-downsampled full-page overview (scratchpad/bphs-p104-overview2.png) and confirming zoom crops (scratchpad/bphs-p104-v36-top.png, -v3-line1-left.png, -right.png at 2x). Line 1 is printed at the page's right edge where the scan shows slight warping/distortion; three words show minor print ambiguity plausibly resolving to standard forms: "चन्द्रा" (as printed) is read as "चन्द्रो" (chandrah + grahaih sandhi, cf. the recurring ो/ा ambiguity noted at verse 9.30's "पापा"/"पापो"); "क्रूरश्च" (as it appears) is read as "क्रूरैश्च" (instrumental plural, grammatically required); and "वाक्षितः" is read as "वीक्षितः" ("aspected", the standard term used throughout this text, e.g. verse 9.31's "प्रपश्यतः"/similar). None of these affect the verse's plain sense. "रिष्फ" is the standard term for the 12th house (cf. verse 9.30's "व्यय" for the same house). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शाशिवन्मृत्युदाः सौम्याश्चेद् वक्राः क्रूरवीक्षिताः । शिशोर्जातस्य मासेन लग्ने सौम्यविवर्जिते ॥ ४ ॥

shaashivanmrityudaah saumyaashcheda vakraah kruuraviikshitaah | shishorjaatasya maasena lagne saumyavivarjite || 4 ||

अंग्रेज़ी अर्थ

Benefic planets (saumyaah), if (chet) retrograde (vakraah) and aspected by malefics (kruura-viikshitaah), cause death (mrityudaah) just as the Moon [does] (shaashivat) -- for a newborn child (shishoh jaatasya), within a month (maasena), if the ascendant (lagne) is devoid of a benefic['s occupation or aspect] (saumya-vivarjite).

हिन्दी अर्थ

यदि (चेत्) शुभ ग्रह (सौम्याः) वक्री (वक्राः) होकर पाप ग्रहों द्वारा देखे जाएं (क्रूरवीक्षिताः), तो वे चन्द्रमा के समान (शाशिवत्) मृत्युदायक (मृत्युदाः) होते हैं -- नवजात शिशु के लिए (शिशोः जातस्य), एक मास के भीतर (मासेन), यदि लग्न शुभ ग्रह से रहित (सौम्यविवर्जिते) हो।

स्रोत: BPHS Ch.10, verse 4, continuing the "अरिष्टयोग" subsection. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.104 (printed page 72). Read from scratchpad/bphs-p104-overview2.png and scratchpad/bphs-p104-v36-top.png (2x), both clearly legible with no significant ambiguity. The opening word is printed "शाशिवन्" (with a long-vowel आ after श) rather than the more standard "शशिवत्" ("like the Moon", from verse 3's चन्द्रः); transcribed exactly as printed per zero-fabrication discipline -- likely a print/sandhi-spelling variant rather than a different word, given the unmistakable शशि/शाशि root and the verse's explicit comparison to the Moon's effect described in verse 3. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यस्य जन्मनि धीस्थाः स्युः सूर्यार्कीन्दुकुजाभिधाः । तस्य त्वाशु जनित्री च भ्राता निधनमाप्नुयात् ॥ ५ ॥

yasya janmani dhiisthaah syuh suuryaarkiindukujaabhidhaah | tasya tvaashu janitrii cha bhraataa nidhanamaapnuyaat || 5 ||

अंग्रेज़ी अर्थ

In whose (yasya) birth [chart] (janmani), [the planets] named (abhidhaah) Surya, Arka, Indu and Kuja [i.e. the Sun, (Arka=Sun), the Moon, and Mars] are situated in the 'dhi' house (dhii-sthaah syuh) -- his (tasya) mother (janitrii) and brother (bhraataa) would quickly (aashu) meet death (nidhanam aapnuyaat).

हिन्दी अर्थ

जिसकी (यस्य) जन्म-कुण्डली में (जन्मनि) सूर्य, अर्क, इन्दु और कुज नामक ग्रह (सूर्यार्कीन्दुकुजाभिधाः) 'धी' भाव में स्थित हों (धीस्थाः स्युः) -- उसकी (तस्य) माता (जननी) और भाई (भ्राता) शीघ्र ही (आशु) मृत्यु को प्राप्त होते हैं (निधनमाप्नुयात्)।

स्रोत: BPHS Ch.10, verse 5, continuing the "अरिष्टयोग" subsection. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.104 (printed page 72). Read from scratchpad/bphs-p104-overview2.png and confirming zoom crops (scratchpad/bphs-p104-v5l1-left.png, -right.png at 2x). Two genuine ambiguities are disclosed rather than silently resolved: (1) the house-term "धीस्थाः" ("situated in the 'dhi' [house]") does not match any of this text's other attested bhava-synonyms seen so far (सुख/तनु/रिष्फ/व्यय etc.); its identity (which house "धी" denotes) is uncertain -- transcribed exactly as printed. (2) "सूर्यार्कीन्दुकुजाभिधाः" literally names four items ("Surya, Arka, Indu, Kuja"), but "सूर्य" and "अर्क" are both standard synonyms for the Sun, making this either a poetic double-epithet for the Sun (for meter) or a possible print/reading variant obscuring a fourth distinct planet-name; translated literally without forcing a resolution. Zoom on the first word also shows "जन्मान" rather than the grammatically expected locative "जन्मनि"; read as जन्मनि per the clearer overview-resolution reading and standard grammar. English/Hindi meanings by Vedic Hora -- for review, translation of this verse carries higher-than-usual uncertainty given the disclosed ambiguities.

संस्कृत

पापेक्षितो युतो भौमो लग्नगो न शुभेक्षितः । मृत्युदस्त्वष्टमस्थोऽपि सौरिणाऽर्केण वाऽन्वितः ॥ ६ ॥

paapekshito yuto bhaumo lagnago na shubhekshitah | mrityudastvashtamasthopi saurinaarkena vaanvitah || 6 ||

अंग्रेज़ी अर्थ

If Mars (bhaumah), aspected by a malefic (paapa-iikshitah) [or] joined with [one] (yutah), is in the ascendant (lagna-gah) [and] not aspected by a benefic (na shubha-iikshitah) -- it causes death (mrityudah); even if [Mars is instead] situated in the 8th house (ashtama-sthah api), [it causes death] if joined with (anvitah) Saturn or (vaa) the Sun (saurinaa arkena).

हिन्दी अर्थ

यदि मंगल (भौमः) पाप ग्रह से देखा जाए (पापेक्षितः) [या] युक्त हो (युतः), लग्न में स्थित हो (लग्नगो), [और] शुभ ग्रह से न देखा जाए (न शुभेक्षितः) -- तो वह मृत्युदायक (मृत्युदः) होता है; यदि [मंगल] अष्टम भाव में स्थित हो (अष्टमस्थोऽपि) तो भी, शनि या (वा) सूर्य से युक्त होने पर (सौरिणाऽर्केण वाऽन्वितः) [मृत्युदायक होता है]।

स्रोत: BPHS Ch.10, verse 6, closing the "अरिष्टयोग" subsection begun at verse 3; followed by a Hindi commentary block (Devchandra Jha) paraphrasing verses 3-6 (beginning "छठे, आठवें या बारहवें..."), excluded from transcription per copyright-safety discipline though read silently to corroborate technical terms (e.g. it uses "त्रिक" for the 6th/8th/12th houses and confirms Saturn/Mars/Sun affliction themes). Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036), PDF p.104 (printed page 72). Read from scratchpad/bphs-p104-overview2.png and scratchpad/bphs-p104-v36-bot.png (2x); both lines and the closing verse-number "॥ ६ ॥" are clearly legible with no significant glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चन्द्र-सूर्यग्रहे राहुश्चन्द्र-सूर्ययुतो यदि । सौरिभौमेक्षितं लग्नं पक्षमेकं स जीवति ॥ ७ ॥

chandra-suuryagrahe raahushchandra-suuryayuto yadi | sauribhaumekshitan lagnan pakshamekan sa jeevati || 7 ||

अंग्रेज़ी अर्थ

If (yadi), at a lunar or solar eclipse (chandra-surya-grahe), Rahu (raahuh) is joined with the Moon or Sun (chandra-surya-yutah), [and] the ascendant (lagnam) is aspected by Saturn and Mars (sauri-bhauma-ikshitam), he [the child] lives (sa jeevati) [only] for one fortnight (paksham ekam).

हिन्दी अर्थ

यदि चन्द्र या सूर्य ग्रहण के समय (चन्द्र-सूर्यग्रहे) राहु (राहुः) चन्द्र या सूर्य से युक्त हो (चन्द्र-सूर्ययुतः), [और] लग्न (लग्नं) शनि-मंगल से दृष्ट हो (सौरिभौमेक्षितं), तो वह [शिशु] (स) केवल एक पक्ष (पक्षमेकं) तक जीवित रहता है (जीवति)।

स्रोत: BPHS Ch.10, verse 7, opening a new page (PDF p.105, printed page 73, running header "अरिष्टविवेचनाध्यायः"). Kashi Sanskrit Series No.220 (ed. Devchandra Jha). Read from the 600dpi full render and a 4x-downsampled overview (scratchpad/bphs-p105-overview.png), which is clearly legible with no glyph-level ambiguity for this verse. Continues directly after a Hindi commentary block (paraphrasing verses 3-6, closing marker "॥ ३-६ ॥" visible at the top of the page) that is excluded from transcription per copyright-safety discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कर्मस्थाने स्थितः सौरिः शत्रुस्थाने कलानिधिः । क्षितिजः सप्तमे मात्रा सार्धं तु म्रियते शिशुः ॥ ८ ॥

karmasthaane sthitah sauriah shatrusthaane kalaanidhih | kshitijah saptame maatraa saardhan tu mriyate shishuh || 8 ||

अंग्रेज़ी अर्थ

[If] Saturn (sauriah) is situated (sthitah) in the 10th house (karma-sthaane), the Moon ('treasury of digits', kalaa-nidhih) in the 6th house/enemy's-place (shatru-sthaane), [and] Mars ('born of the earth', kshitijah) in the 7th (saptame) -- the child (shishuh) dies (mriyate) together with (saardham) the mother (maatraa).

हिन्दी अर्थ

[यदि] शनि (सौरिः) दशम भाव में (कर्मस्थाने) स्थित हो, चन्द्रमा (कलानिधिः, "कलाओं का भण्डार") शत्रु-स्थान अर्थात् षष्ठ भाव में (शत्रुस्थाने) हो, और मंगल (क्षितिजः, "पृथ्वी-पुत्र") सप्तम भाव में (सप्तमे) हो -- तो शिशु (शिशुः) माता के साथ (मात्रा सार्धं) मृत्यु को प्राप्त होता है (म्रियते)।

स्रोत: BPHS Ch.10, verse 8. PDF p.105 (printed page 73). Read from scratchpad/bphs-p105-overview.png and a dedicated targeted zoom (scratchpad/bphs-p105-v8-word2.png, high magnification) on the verse's fourth word. The zoom shows an ambiguous conjunct that could be read as "त्रियते" or "म्रियते"; "त्रियते" is not a valid Sanskrit word, while "म्रियते" ("dies", from the root mrī) both is grammatically valid and fits the verse's death-prediction context (paired with "मात्रा सार्धं", "together with the mother") -- so "म्रियते" is adopted, with this print-quality ambiguity disclosed per the zero-fabrication/disclosure discipline. "कलानिधिः" (Moon) and "क्षितिजः" (Mars) are standard poetic epithets/synonyms for these planets in this text. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्ने भास्करपुत्रश्च निधने चन्द्रमा यदि । तृतीयस्थो यदा जीवः स याति यममन्दिरम् ॥ ९ ॥

lagne bhaaskaraputrashcha nidhane chandramaa yadi | tritiiyastho yadaa jeevah sa yaati yamamandiram || 9 ||

अंग्रेज़ी अर्थ

If (yadi) Saturn ('son of the Sun', bhaaskara-putrah) [is] in the ascendant (lagne), and the Moon (chandramaa) in the 8th house/house-of-death (nidhane), [and] when (yadaa) Jupiter (jeevah) is situated in the 3rd (triteeya-sthah), he [the child] (sah) goes (yaati) to Yama's abode (yama-mandiram), [i.e. dies].

हिन्दी अर्थ

यदि लग्न में (लग्ने) शनि (भास्करपुत्रः, "सूर्य-पुत्र") हो, और अष्टम/निधन-स्थान में (निधने) चन्द्रमा (चन्द्रमा) हो, तथा जब तृतीय भाव में (तृतीयस्थः) गुरु (जीवः) हो, तो वह [शिशु] (स) यम के धाम (यममन्दिरम्) को प्राप्त होता है (याति), अर्थात् मृत्यु को प्राप्त होता है।

स्रोत: BPHS Ch.10, verse 9. PDF p.105 (printed page 73). Read from scratchpad/bphs-p105-overview.png, clearly legible with no glyph-level ambiguity. "भास्करपुत्रः" ("son of the Sun") is the standard epithet for Saturn; "जीवः" ("the living one") is a standard epithet for Jupiter; "यममन्दिरम्" ("Yama's abode") is a standard poetic euphemism for death. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

होरायां नवमे सूर्यः सप्तमस्थः शनैश्वरः । एकादशे गुरुः शुक्रो मासमेकं स जीवति ॥ १० ॥

horaayaan navame suuryah saptamasthah shanaishvarah | ekaadashe guruh shukro maasamekan sa jeevati || 10 ||

अंग्रेज़ी अर्थ

[If] the Sun (suryah) [is placed] in the hora of the 9th [house] (horaayaam navame -- exact technical sense uncertain), Saturn (shanaishvarah) [is] situated in the 7th (saptama-sthah), [and] Jupiter and Venus (guruh shukrah) [are] in the 11th (ekaadashe), he [the child] lives (sa jeevati) [only] one month (maasam ekam).

हिन्दी अर्थ

[यदि] सूर्य (सूर्यः) नवम भाव की होरा में (होरायां नवमे -- ठीक तकनीकी अर्थ अनिश्चित) हो, शनि (शनैश्वरः) सप्तम भाव में स्थित हो (सप्तमस्थः), और एकादश भाव में (एकादशे) गुरु-शुक्र (गुरुः शुक्रः) हों, तो वह [शिशु] (स) केवल एक मास (मासमेकं) तक जीवित रहता है (जीवति)।

स्रोत: BPHS Ch.10, verse 10. PDF p.105 (printed page 73). Read from scratchpad/bphs-p105-overview.png and cross-checked with scratchpad/bphs-p105-v11b.png (a targeted zoom covering this verse's tail and verse 11's start). The compound "होरायां नवमे" is unusual -- it may denote a specific divisional/positional technical sense (the "hora" half of the 9th sign/house) rather than two separate placements; this residual technical-term uncertainty is disclosed rather than forced to a confident resolution, per the established pattern (cf. verse 5's "धीस्थाः"). The non-standard spelling "शनैश्वरः" (श्व instead of the more common श्च) is confirmed here as a recurring edition-wide convention, having first appeared at verse 9.29 and again at verse 10.10. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

व्यये सर्वे ग्रहा नेष्टाः सूर्य-शुक्रेन्दु-राहवः । विशेषतो नाशकर्तारो दृष्ट्या वा भङ्गकारिणः ॥ ११ ॥

vyaye sarve grahaa neshtaah suurya-shukrendu-raahavah | visheshato naashakartaaro drishtyaa vaa bhangakaarinah || 11 ||

अंग्रेज़ी अर्थ

All the planets (sarve grahaah) in the 12th house (vyaye) are inauspicious (neshtaah) [for the child] -- the Sun, Venus, the Moon and Rahu (surya-shukra-indu-raahavah) especially (visheshatah) [being] destruction-causers (naashakartaarah), or by [their] aspect (drishtyaa vaa) cancellation-causers (bhangakaarinah) [of the yogas described above].

हिन्दी अर्थ

द्वादश भाव में (व्यये) सभी ग्रह (सर्वे ग्रहाः) अशुभ होते हैं (नेष्टाः) [शिशु के लिये] -- सूर्य, शुक्र, चन्द्र और राहु (सूर्य-शुक्रेन्दु-राहवः) विशेष रूप से (विशेषतः) नाश करने वाले होते हैं (नाशकर्तारः), अथवा दृष्टि से (दृष्ट्या वा) [उपर्युक्त योगों के] भङ्ग करने वाले होते हैं (भङ्गकारिणः)।

स्रोत: BPHS Ch.10, verse 11. PDF p.105 (printed page 73). Line 1 read from scratchpad/bphs-p105-overview.png and confirmed via scratchpad/bphs-p105-v11b.png/-left.png/-right.png; two targeted word-level zooms (scratchpad/bphs-p105-v11-word.png, blank due to a coordinate error, and -v11-word2.png, partial/inconclusive) were attempted on the compound "शुक्रेन्दु"/"शुक्रेन्द्र" without full resolution, but the clearer overview render shows "शुक्रेन्दु" (Venus+Moon), which is adopted as it is contextually sound for a list of planets (Sun, Venus, Moon, Rahu) -- "शुक्रेन्द्र" (with Indra, not a planet) does not fit. Line 2's compound "विशेषतो नाशकर्तारो" is read with residual uncertainty from the page's print compression; an alternative literal-looking rendering could suggest "विशेषान्ताशकर्तारो", which does not parse as valid Sanskrit, so the grammatically sound "विशेषतो नाशकर्तारो" is adopted, disclosed here per the zero-fabrication/disclosure discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पापान्वितः शशी धर्ष-घ्न-लग्नगतो यदि । शुभैर्ने चेदीक्षितयुतस्तदा मृत्युप्रदः शिशोः ॥ १२ ॥

paapaanvitah shashii dharsha-ghna-lagnagato yadi | shubhairne chedeekshitayutastadaa mrityupradah shishoh || 12 ||

अंग्रेज़ी अर्थ

If (yadi) the Moon (shashii), joined with malefics (paapa-anvitah), is situated in the ascendant in a "dharsha-ghna" [position -- term uncertain] (dharsha-ghna-lagnagatah), [and] if it is not aspected by or joined with benefics (shubhaih na cha eekshita-yutah), then (tadaa) it is a giver of death (mrityu-pradah) to the child (shishoh).

हिन्दी अर्थ

यदि लग्न में (लग्नगतः) पापयुक्त चन्द्रमा (पापान्वितः शशी) "धर्ष-घ्न" [स्थिति -- शब्द का ठीक अर्थ अनिश्चित] (धर्ष-घ्न-लग्नगतः) में हो, और यदि वह शुभ ग्रहों से दृष्ट अथवा युक्त न हो (शुभैर्ने चेदीक्षितयुतः), तो (तदा) वह शिशु (शिशोः) के लिये मृत्युदायक होता है (मृत्युप्रदः)।

स्रोत: BPHS Ch.10, verse 12. PDF p.105 (printed page 73). Confirmed via scratchpad/bphs-p105-v12-15b.png ("-top.png"), clearly legible for every syllable, but the compound "धर्ष-घ्न" is not a jyotish term I can confidently identify or parse (possibly related to a specific affliction-yoga name); this residual semantic uncertainty is disclosed rather than resolved, per the established disclosure discipline (cf. verse 5's "धीस्थाः"). This verse immediately follows the Hindi commentary block (Devchandra Jha) explicitly marked "॥ ७-११ ॥" (paraphrasing verses 7-11), which is excluded from transcription per copyright-safety discipline but corroborates the verse-numbering of the preceding Sanskrit. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सन्ध्यायां चन्द्रहोरायां गण्डान्ते निधनाय वै । प्रत्येकं चन्द्रपापैश्च केन्द्रगैः स्याद् विनाशनम् ॥ १३ ॥

sandhyaayaan chandrahoraayaan gandaante nidhanaaya vai | pratyekan chandrapaapaishcha kendragaih syaad vinaashanam || 13 ||

अंग्रेज़ी अर्थ

At twilight (sandhyaayaam), in the Moon's hora (chandra-horaayaam), [or] at a gandanta [time-junction point] (gandaante) -- [these are] indeed (vai) for death (nidhanaaya). Each [of these] (pratyekam), when the Moon [is] with malefics (chandra-paapaih cha) situated in the angular houses (kendragaih), causes (syaat) destruction (vinaashanam).

हिन्दी अर्थ

सन्ध्या के समय (सन्ध्यायां), चन्द्रमा की होरा में (चन्द्रहोरायां), अथवा गण्डान्त पर (गण्डान्ते) -- ये निश्चय ही (वै) मृत्यु के लिये होते हैं (निधनाय)। इनमें से प्रत्येक (प्रत्येकं), जब चन्द्रमा पाप ग्रहों सहित (चन्द्रपापैश्च) केन्द्र भावों में स्थित हो (केन्द्रगैः), विनाश उत्पन्न करता है (स्याद् विनाशनम्)।

स्रोत: BPHS Ch.10, verse 13. PDF p.105 (printed page 73). Confirmed via scratchpad/bphs-p105-v12-15b.png ("-bot.png") and scratchpad/bphs-p105-v13-15.png ("-top.png"), clearly legible with no glyph-level ambiguity. "गण्डान्त" ("gandanta", the junction-points of time considered highly inauspicious, e.g. between water and fire signs) is independently confirmed here as a genuine, well-known jyotish technical term, corroborating that the surrounding text is being read correctly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रवेस्तु मण्डलार्धास्तात् सायं सन्ध्या त्रिनाडिका । तथैवार्धोदयात्पूर्वं प्रातः सन्ध्या त्रिनाडिका ॥ १४ ॥

ravestu mandalaardhaastaat saayan sandhyaa trinaadikaa | tathaivaardhodayaatpuurvan praatah sandhyaa trinaadikaa || 14 ||

अंग्रेज़ी अर्थ

From half the Sun's disc having set (raveh tu mandala-ardha-astaat), the evening twilight (saayam sandhyaa) [lasts] three nadikas (trinaadikaa). Likewise (tathaiva), before half [the disc's] rising (ardha-udayaat puurvam), the morning twilight (praatah sandhyaa) [lasts] three nadikas (trinaadikaa).

हिन्दी अर्थ

सूर्य के मण्डल का आधा भाग अस्त होने से (रवेस्तु मण्डलार्धास्तात्) सायं सन्ध्या (सायं सन्ध्या) तीन नाडिका (त्रिनाडिका) तक होती है। इसी प्रकार (तथैव), आधा उदय होने से पूर्व (अर्धोदयात्पूर्वं) प्रातः सन्ध्या (प्रातः सन्ध्या) तीन नाडिका (त्रिनाडिका) तक होती है।

स्रोत: BPHS Ch.10, verse 14, defining the technical duration of morning/evening twilight (sandhya) used in verse 13. PDF p.105 (printed page 73). Line 1 confirmed via scratchpad/bphs-p105-v13-15.png ("-bot.png") and scratchpad/bphs-p105-v14-15.png ("-top.png"); line 2 confirmed via scratchpad/bphs-p105-v14l2-v15-top.png and -bot.png (both split from a targeted crop of the page region y=3900-4300). All words clearly legible with no glyph-level ambiguity. "त्रिनाडिका" ("three nadikas", approx. 72 minutes) is a standard jyotish time-unit term. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चक्र-पूर्वापरार्धेषु क्रूर-सौम्येषु कीटभे । लग्नगे निधनं याति नात्र कार्या विचारणा ॥ १५ ॥

chakra-puurvaaparaardheshu kroora-saumyeshu kiitabhe | lagnage nidhanan yaati naatra kaaryaa vichaaranaa || 15 ||

अंग्रेज़ी अर्थ

In the first and second halves of the zodiac-circle (chakra-puurva-apara-ardheshu), among malefics and benefics (kroora-saumyeshu), [at a specific point whose reading is uncertain, tentatively "kiitabhe"] -- if [the Moon/relevant significator] is situated in the ascendant (lagnage), [the child] goes to death (nidhanam yaati); here (atra) there is no need for [further] deliberation (na kaaryaa vichaaranaa), [i.e., the result is certain].

हिन्दी अर्थ

चक्र के पूर्वार्ध और अपरार्ध में (चक्र-पूर्वापरार्धेषु), पाप और शुभ ग्रहों के मध्य (क्रूर-सौम्येषु), [एक अनिश्चित पद पर, सम्भवतः "कीटभे"] -- यदि [चन्द्रमा/सम्बन्धित ग्रह] लग्न में स्थित हो (लग्नगे), तो [शिशु] मृत्यु को प्राप्त होता है (निधनं याति); यहाँ (अत्र) और विचार करने की आवश्यकता नहीं है (न कार्या विचारणा)।

स्रोत: BPHS Ch.10, verse 15. PDF p.105 (printed page 73), read from scratchpad/bphs-p105-overview.png; line 2 ("लग्नगे निधनं याति नात्र कार्या विचारणा") is clearly legible with no ambiguity, but line 1's third word (rendered here as "कीटभे") is not a jyotish term I can confidently identify from the overview resolution alone -- it may denote a specific degree-range or asterism reference within the zodiac's first/second half. This word-level uncertainty is disclosed per the zero-fabrication/disclosure discipline rather than forced to a confident resolution; a higher-resolution zoom crop of this specific word was not obtained before this seeding pass and may warrant later re-verification. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

व्ययशत्रुगतैः क्रूरैर्मृत्यु-द्रव्यगतैरपि । पापमध्यगते लग्ने सत्यमेव मृतिं वदेत् ॥ १६ ॥

vyayashatrugataih krooraih mrityu-dravyagatairapi | paapamadhyagate lagne satyameva mritin vadet || 16 ||

अंग्रेज़ी अर्थ

By malefics (krooraih) situated in the 12th and 6th houses (vyaya-shatru-gataih), also (api) [by those] situated in placements related to death/wealth [the 8th and 2nd houses] (mrityu-dravya-gataih) -- [if] the ascendant is situated between [two] malefics (paapa-madhyagate lagne), one should truly (satyam eva) declare (vadet) death (mritim).

हिन्दी अर्थ

द्वादश और षष्ठ भाव में स्थित पाप ग्रहों से (व्ययशत्रुगतैः क्रूरैः), तथा मृत्यु-धन सम्बन्धी [अष्टम-द्वितीय] भावों में स्थित ग्रहों से भी (मृत्यु-द्रव्यगतैरपि) -- यदि लग्न दो पाप ग्रहों के मध्य स्थित हो (पापमध्यगते लग्ने), तो निश्चय ही (सत्यमेव) मृत्यु (मृतिं) कहनी चाहिए (वदेत्)।

स्रोत: BPHS Ch.10, verse 16, spanning the page break between PDF p.105 (printed page 73) and PDF p.106 (printed page 74, running header "बृहत्पाराशरहोराशास्त्रम्"). Line 1 confirmed via scratchpad/bphs-p105-v16-line1-full.png (a targeted zoom of the last visible line at the bottom of page 105); line 2 confirmed via scratchpad/bphs-p106-v16-17.png. "पापमध्यगते लग्ने" (the ascendant flanked between two malefics) reflects the classic "paapakartari" affliction pattern. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्न-सप्तमगौ पापौ चन्द्रोऽपि क्रूरसंयुतः । यदा त्वनीक्षितः सौम्यैः शीघ्रान्मृत्युर्भवेत्तदा ॥ १७ ॥

lagna-saptamagau paapau chandro'pi kroorasanyutah | yadaa tvaniikshitah saumyaih shiighraanmrityurbhavettadaa || 17 ||

अंग्रेज़ी अर्थ

[If] the lords of the ascendant and the 7th house (lagna-saptama-gau) [are] malefic (paapau), [and] the Moon too (chandrah api) [is] joined with a malefic (kroora-samyutah), when (yadaa), moreover (tu), it [remains] unaspected (aniikshitah) by benefics (saumyaih), then (tadaa) death (mrityuh) would occur (bhavet) quickly (shiighraat).

हिन्दी अर्थ

यदि लग्न और सप्तम भाव के स्वामी (लग्न-सप्तमगौ) पाप ग्रह हों (पापौ), और चन्द्रमा भी (चन्द्रोऽपि) पाप ग्रह से युक्त हो (क्रूरसंयुतः), और जब (यदा) वह शुभ ग्रहों से दृष्ट न हो (त्वनीक्षितः सौम्यैः), तब (तदा) शीघ्र ही मृत्यु होती है (शीघ्रान्मृत्युर्भवेत्)।

स्रोत: BPHS Ch.10, verse 17. PDF p.106 (printed page 74). Confirmed via scratchpad/bphs-p106-v16-17.png. The third word of line 2 is printed in a compressed/distorted form that could be read as "त्वप्वीक्षितः" (not a valid word) or "त्वनीक्षितः" ("tu" + "aniikshitah", "but/moreover, not aspected") -- the latter is grammatically valid and fits the verse's sense, so it is adopted, with the print-quality ambiguity disclosed per the zero-fabrication/disclosure discipline. This verse and verse 16 are paraphrased together with verses 12-15 in the following Hindi commentary block (Devchandra Jha), explicitly marked "॥ १२-१७ ॥", which is excluded from transcription per copyright-safety discipline but corroborates the verse count and general themes (twilight, gandanta, chakra-halves) of this span. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

क्षीणे शशिनि लग्नस्थे पापैः केन्द्राष्टसंस्थितैः । यो जातो मृत्युमाप्नोति स विप्रेश ! न संशयः ॥ १८ ॥

kshiine shashini lagnasthe paapaih kendraashtasansthitaih | yo jaato mrityumaapnoti sa vipresha ! na sanshayah || 18 ||

अंग्रेज़ी अर्थ

When the waning Moon (kshiine shashini) is situated in the ascendant (lagna-sthe), [afflicted] by malefics (paapaih) situated in the angles or the 8th house (kendra-ashta-sansthitaih) -- whoever is thus born (yah jaatah) attains death (mrityum aapnoti); O best of the twice-born (vipresha)! there is no doubt (na sanshayah).

हिन्दी अर्थ

जब क्षीण चन्द्रमा (क्षीणे शशिनि) लग्न में स्थित हो (लग्नस्थे), और केन्द्र या अष्टम भाव में स्थित पाप ग्रहों से (पापैः केन्द्राष्टसंस्थितैः) [पीड़ित हो] -- तो जो जातक इस प्रकार जन्मा हो (यो जातः) वह मृत्यु को प्राप्त होता है (मृत्युमाप्नोति); हे श्रेष्ठ ब्राह्मण (विप्रेश)! इसमें सन्देह नहीं है (न संशयः)।

स्रोत: BPHS Ch.10, verse 18, opening a new group of Sanskrit verses (18-23) after the "१२-१७" Hindi commentary block. PDF p.106 (printed page 74). Confirmed via scratchpad/bphs-p106-v18-23-top.png, clearly legible with no glyph-level ambiguity. "विप्रेश" ("O lord/best of Brahmins") is a vocative honorific addressed to Maitreya, consistent with his role as a learned Brahmin disciple throughout the text. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पापयोर्मध्यगश्चन्द्रो लग्नाष्टान्त्यकलत्रगः । अचिरान्मृत्युमाप्नोति यो जातः स शिशुस्तदा ॥ १९ ॥

paapayormadhyagashchandro lagnaashtaantyakalatragah | achiraanmrityumaapnoti yo jaatah sa shishustadaa || 19 ||

अंग्रेज़ी अर्थ

The Moon (chandrah) situated between two malefics (paapayoh madhyagah), placed in the ascendant, the 8th, the 12th, or the 7th house (lagna-ashta-antya-kalatra-gah) -- the child (shishuh) who is thus born (yah jaatah) attains death (mrityum aapnoti) soon (achiraat).

हिन्दी अर्थ

दो पाप ग्रहों के मध्य स्थित चन्द्रमा (पापयोर्मध्यगश्चन्द्रो), जो लग्न, अष्टम, द्वादश या सप्तम भाव में हो (लग्नाष्टान्त्यकलत्रगः) -- ऐसा जन्मा शिशु (यो जातः स शिशुः) शीघ्र ही मृत्यु को प्राप्त होता है (अचिरान्मृत्युमाप्नोति)।

स्रोत: BPHS Ch.10, verse 19. PDF p.106 (printed page 74). Confirmed via scratchpad/bphs-p106-v18-23-top.png, clearly legible with no glyph-level ambiguity. "अन्त्य" ("the last [house]", i.e. the 12th) and "कलत्र" ("spouse's house", i.e. the 7th) are standard poetic synonyms for these houses in this text. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पापद्वय-मध्यगते चन्द्रे लग्नसमाश्रिते । सप्ताष्टगेन पापेन मात्रा सह मृतः शिशुः ॥ २० ॥

paapadvaya-madhyagate chandre lagnasamaashrite | saptaashtagena paapena maatraa saha mritah shishuh || 20 ||

अंग्रेज़ी अर्थ

When the Moon, situated between two malefics (paapa-dvaya-madhyagate chandre), is placed in the ascendant (lagna-samaashrite), [and afflicted] by a malefic situated in the 7th or 8th house (sapta-ashtagena paapena) -- the child (shishuh) dies (mritah) together with (saha) the mother (maatraa).

हिन्दी अर्थ

जब दो पाप ग्रहों के मध्य स्थित चन्द्रमा (पापद्वय-मध्यगते चन्द्रे) लग्न में स्थित हो (लग्नसमाश्रिते), और सप्तम या अष्टम भाव में स्थित पाप ग्रह से (सप्ताष्टगेन पापेन) [पीड़ित हो] -- तो शिशु (शिशुः) माता के साथ (मात्रा सह) मृत्यु को प्राप्त होता है (मृतः)।

स्रोत: BPHS Ch.10, verse 20. PDF p.106 (printed page 74). Confirmed via scratchpad/bphs-p106-v18-23-bot.png, clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शनैश्चरार्कभौमेषु रिष्फ-धर्माष्टगेषु च । शुभैरवीक्ष्यमाणेषु यो जातो निधनं गतः ॥ २१ ॥

shanaishcharaarkabhaumeshu rishpha-dharmaashtageshu cha | shubhairaveekshyamaaneshu yo jaato nidhanan gatah || 21 ||

अंग्रेज़ी अर्थ

When Saturn, the Sun and Mars (shanaishchara-arka-bhaumeshu) are situated in the 12th, 9th or 8th houses (rishpha-dharma-ashta-geshu cha), unaspected (aveekshyamaaneshu) by benefics (shubhaih) -- whoever is thus born (yah jaatah) goes to death (nidhanam gatah).

हिन्दी अर्थ

जब शनि, सूर्य और मंगल (शनैश्चरार्कभौमेषु) द्वादश, नवम या अष्टम भाव में स्थित हों (रिष्फ-धर्माष्टगेषु च), और शुभ ग्रहों से न देखे जाते हों (शुभैरवीक्ष्यमाणेषु) -- तो ऐसा जन्मा जातक (यो जातः) मृत्यु को प्राप्त होता है (निधनं गतः)।

स्रोत: BPHS Ch.10, verse 21. PDF p.106 (printed page 74). Confirmed via scratchpad/bphs-p106-v21-23.png. The first word's compound is printed with a bindu/anusvara mark on "कैं" that does not fit standard sandhi ("शनैश्वराकैंभौमेषु" as literally rendered); the grammatically standard compound "शनैश्चरार्कभौमेषु" (Saturn+Sun+Mars) is adopted instead, with this print-quality ambiguity disclosed. "रिष्फ" (12th house), "धर्म" (9th house) and "अष्ट" (8th house) are standard bhava-synonyms used throughout this text. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यद्द्रेष्काणे च यामित्रे यस्य स्यादारुणो ग्रहः । क्षीणचन्द्रो विलग्नस्थः सद्यो हरति जीवितम् ॥ २२ ॥

yaddreshkaane cha yaamitre yasya syaadaaruno grahah | kshiinachandro vilagnasthah sadyo harati jeevitam || 22 ||

अंग्रेज़ी अर्थ

If, in the drekkana [decanate] of the 7th house (yad-drekkaane cha yaamitre), one has a fierce/reddish planet (yasya syaat aarunah grahah) [placed], [and] the waning Moon (kshiina-chandrah) is situated in the ascendant (vi-lagna-sthah), it instantly (sadyah) takes away (harati) life (jeevitam).

हिन्दी अर्थ

यदि सप्तम भाव के द्रेष्काण में (यद्द्रेष्काणे च यामित्रे) किसी का उग्र/लाल ग्रह हो (यस्य स्यादारुणो ग्रहः), और क्षीण चन्द्रमा (क्षीणचन्द्रो) लग्न में स्थित हो (विलग्नस्थः), तो वह तुरन्त (सद्यो) जीवन को हर लेता है (हरति जीवितम्)।

स्रोत: BPHS Ch.10, verse 22. PDF p.106 (printed page 74). Confirmed via scratchpad/bphs-p106-v21-23.png. "आरुणो ग्रहः" ("the reddish/fierce planet") is translated generically as it could denote a malefic in general or specifically the Sun/Mars (both associated with the color red, aruna, in this text's imagery); this residual semantic breadth is disclosed rather than forced to one specific planet. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

आपोक्लिमस्थिताः सर्वे ग्रहा बलविवर्जिताः । षण्मासं वा द्विमासं वा तस्यायुः समुदाहृतम् ॥ २३ ॥

aapoklimasthitaah sarve grahaa balavivarjitaah | shanmaasan vaa dvimaasan vaa tasyaayuh samudaahritam || 23 ||

अंग्रेज़ी अर्थ

[If] all the planets (sarve grahaah) are situated in the cadent houses (aapoklima-sthitaah), devoid of strength (bala-vivarjitaah), his/her life (tasya aayuh) is declared (samudaahritam) to be six months (shanmaasam) or (vaa) two months (dvimaasam).

हिन्दी अर्थ

यदि सभी ग्रह (सर्वे ग्रहाः) अपोक्लिम [३, ६, ९, १२] भावों में स्थित हों (आपोक्लिमस्थिताः), और बलहीन हों (बलविवर्जिताः), तो उसकी आयु (तस्यायुः) छह मास (षण्मासं) या (वा) दो मास (द्विमासं) कही गई है (समुदाहृतम्)।

स्रोत: BPHS Ch.10, verse 23, closing this group of verses before the next Hindi commentary block. PDF p.106 (printed page 74). Confirmed via scratchpad/bphs-p106-v21-23.png and cross-checked against scratchpad/bphs-p106-overview.png. "अपोक्लिम" ("apoklima", the cadent houses: 3, 6, 9, 12) is a standard jyotish technical term. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मातृकष्ट विचार-- पापैः खेटैस्त्रिभिश्चन्द्रो दृश्यते यदि जन्मनि । मातृनाशो भवेत्तस्य शुभैर्दृष्टे शुभं वदेत् ॥ २४ ॥

maatrikashta vichaara-- paapaih khetaistribhishchandro drishyate yadi janmani | maatrinaasho bhavettasya shubhairdrishte shubhan vadet || 24 ||

अंग्रेज़ी अर्थ

[Consideration of the mother's affliction --] If, at birth (janmani), the Moon (chandrah) is seen/aspected (drishyate) by three malefic planets (paapaih khetaih tribhih) -- for him/her (tasya) there would be destruction of the mother (maatri-naashah bhavet); if aspected by benefics (shubhaih drishte), one should declare (vadet) an auspicious result (shubham).

हिन्दी अर्थ

[माता की पीड़ा का विचार --] यदि जन्म के समय (जन्मनि) चन्द्रमा (चन्द्रः) तीन पाप ग्रहों से देखा जाए (पापैः खेटैस्त्रिभिः दृश्यते), तो उसकी (तस्य) माता का नाश होता है (मातृनाशो भवेत्); यदि शुभ ग्रहों से दृष्ट हो (शुभैर्दृष्टे), तो शुभ फल कहना चाहिए (शुभं वदेत्)।

स्रोत: BPHS Ch.10, opening a new subsection "मातृकष्ट विचार" ("consideration of the mother's affliction/hardship") with verse 24, prefixed per the established subsection-heading convention (cf. "अरिष्टयोग--" at verse 10.3). PDF p.107 (printed page 75, running header "अरिष्टविवेचनाध्यायः"). Kashi Sanskrit Series No.220 (ed. Devchandra Jha). Read from the 4x-downsampled overview (scratchpad/bphs-p107-overview.png) and confirmed via zoom scratchpad/bphs-p107-v24-27.png; this page also carries the closing Hindi commentary for verses 18-23 (marked "॥ १८-२३ ॥"), excluded from transcription per copyright-safety discipline. The word "भवेत्तस्य" is printed with a slightly distorted व-glyph (rendering close to "भभेत्तस्य") but the grammatically standard "भवेत्तस्य" is clearly intended and adopted, with the print-quality artifact disclosed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धने राहुर्बुधः शुक्रः सौरिः सूर्यो यदा स्थितः । तस्य मातुर्भवेन्मृत्युर्मृते पितरि जायते ॥ २५ ॥

dhane raahurbudhah shukrah sauriah suuryo yadaa sthitah | tasya maaturbhavenmrityurmrite pitari jaayate || 25 ||

अंग्रेज़ी अर्थ

When Rahu, Mercury, Venus, Saturn, or the Sun (raahuh budhah shukrah sauriah suryah) is situated in the 2nd house (dhane... sthitah) -- the death of his/her mother (tasya maatuh mrityuh) would occur (bhavet), arising (jaayate) when the father is [already] dead (mrite pitari).

हिन्दी अर्थ

जब राहु, बुध, शुक्र, शनि या सूर्य (राहुः बुधः शुक्रः सौरिः सूर्यः) धन भाव (द्वितीय भाव) में स्थित हों (धने... स्थितः), तो उसकी (तस्य) माता की मृत्यु होती है (मातुर्भवेन्मृत्युः), जो पिता के मृत होने पर उत्पन्न होती है (मृते पितरि जायते)।

स्रोत: BPHS Ch.10, verse 25, continuing the "मातृकष्ट विचार" subsection. PDF p.107 (printed page 75). Line 1 read from scratchpad/bphs-p107-v24-27.png; line 2 confirmed via scratchpad/bphs-p107-v25-29.png. Both lines clearly legible with no glyph-level ambiguity, though the precise causal relationship between the father's and mother's deaths implied by "मृते पितरि जायते" is expressed somewhat elliptically in the source and is translated as literally as possible. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पापात्सप्तम-रन्ध्रस्थे चन्द्रे पापसमन्विते । बलिभिः पापकैर्दृष्टे जातो भवति मातृहा ॥ २६ ॥

paapaatsaptama-randhrasthe chandre paapasamanvite | balibhih paapakairdrishte jaato bhavati maatrihaa || 26 ||

अंग्रेज़ी अर्थ

[If] the Moon, situated in the 7th [house] or the 8th house from a malefic (paapaat saptama-randhra-sthe chandre), joined with malefics (paapa-samanvite), [is] aspected (drishte) by strong malefics (balibhih paapakaih) -- the one thus born (jaatah) becomes (bhavati) a killer of the mother (maatri-haa).

हिन्दी अर्थ

यदि पाप ग्रह से सप्तम या अष्टम भाव में स्थित चन्द्रमा (पापात्सप्तम-रन्ध्रस्थे चन्द्रे), पाप ग्रहों से युक्त हो (पापसमन्विते), और बलवान पाप ग्रहों से दृष्ट हो (बलिभिः पापकैर्दृष्टे) -- तो ऐसा जन्मा जातक (जातः) माता का घातक होता है (भवति मातृहा)।

स्रोत: BPHS Ch.10, verse 26. PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v25-29.png, clearly legible. The compound "पापात्सप्तम-रन्ध्रस्थे" is parsed as "situated in the 7th or 8th house counted from a malefic planet", the most grammatically coherent reading, though the precise scope (7th-from-malefic vs. 8th-from-malefic as alternatives, or a single combined count) carries minor residual ambiguity, disclosed here. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

उच्चस्थो वाऽथ नीचस्थः सप्तमस्थो यदा रविः । पानहीनो भवेद् वालस्त्वजा क्षीरेण जीवति ॥ २७ ॥

uchchastho vaa'tha niichasthah saptamastho yadaa ravih | paanahiino bhaved vaalastvajaa ksheerena jeevati || 27 ||

अंग्रेज़ी अर्थ

When the Sun (ravih), exalted (uchcha-sthah), or (vaa atha) debilitated (neecha-sthah), [or] situated in the 7th house (saptama-sthah) -- the infant (baalah) would be deprived of [mother's] milk (paana-hiinah bhavet), but (tu) lives (jeevati) on goat's milk (ajaa ksheerena).

हिन्दी अर्थ

जब सूर्य (रविः) उच्च का हो (उच्चस्थः), अथवा नीच का हो (नीचस्थः), या सप्तम भाव में स्थित हो (सप्तमस्थः) -- तो शिशु (वालः) माता के दूध से वंचित रहता है (पानहीनो भवेत्), परन्तु (तु) बकरी के दूध से (अजा क्षीरेण) जीवित रहता है (जीवति)।

स्रोत: BPHS Ch.10, verse 27. PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v25-29.png, clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चन्द्राच्चतुर्थगः पापो रिपुक्षेत्रे यदा भवेत् । तदा मातृवधं कुर्यात् केन्द्रे यदि शुभो न चेत् ॥ २८ ॥

chandraachchaturthagah paapo ripukshetre yadaa bhavet | tadaa maatrivadhan kuryaat kendre yadi shubho na chet || 28 ||

अंग्रेज़ी अर्थ

When (yadaa) a malefic (paapah), situated four [houses] from the Moon (chandraat chaturtha-gah), is (bhavet) in an enemy's sign (ripu-kshetre) -- then (tadaa) it would cause (kuryaat) the mother's death (maatri-vadham), if (yadi) a benefic is not (na chet) in a kendra (kendre).

हिन्दी अर्थ

जब चन्द्रमा से चतुर्थ भाव में स्थित (चन्द्राच्चतुर्थगः) पाप ग्रह (पापः) शत्रु की राशि में हो (रिपुक्षेत्रे), तो (तदा) वह माता का वध करता है (मातृवधं कुर्यात्), यदि केन्द्र में शुभ ग्रह न हो (केन्द्रे यदि शुभो न चेत्)।

स्रोत: BPHS Ch.10, verse 28. PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v28-31.png, clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्वादशे रिपुभावे च यदा पापग्रहो भवेत् । तदा मातुर्भयं विद्याच्चतुर्थे दशमे पितुः ॥ २९ ॥

dvaadashe ripubhaave cha yadaa paapagraho bhavet | tadaa maaturbhayan vidyaachchaturthe dashame pituh || 29 ||

अंग्रेज़ी अर्थ

And when (cha yadaa) a malefic planet (paapa-grahah) is (bhavet) in the 12th house or the 6th house (dvaadashe ripu-bhaave) -- then (tadaa) one should know (vidyaat) [there is] danger for the mother (maatuh bhayam); [similarly, if] in the 4th or the 10th house (chaturthe dashame), for the father (pituh).

हिन्दी अर्थ

और जब (च यदा) पाप ग्रह (पापग्रहः) द्वादश या षष्ठ भाव में हो (द्वादशे रिपुभावे), तब (तदा) माता के लिये भय जानना चाहिए (मातुर्भयं विद्यात्); [इसी प्रकार] चतुर्थ या दशम भाव में हो तो (चतुर्थे दशमे), पिता के लिये (पितुः) [भय जानना चाहिए]।

स्रोत: BPHS Ch.10, verse 29. PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v28-31.png, clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्ने क्रूरो व्यये क्रूरो धनेऽसौम्यस्तथैव च । सप्तमे भवने क्रूरः परिवारक्षयङ्करः ॥ ३० ॥

lagne krooro vyaye kroaro dhane'saumyastathaiva cha | saptame bhavane kroorah parivaarakshayankarah || 30 ||

अंग्रेज़ी अर्थ

[If there is] a malefic in the ascendant (lagne kroorah), a malefic in the 12th (vyaye kroorah), likewise (tathaiva cha) an inauspicious [planet] in the 2nd house (dhane asaumyah), [and] a malefic in the 7th house (saptame bhavane kroorah) -- it is destructive of the family/household (parivaara-kshaya-nkarah).

हिन्दी अर्थ

यदि लग्न में पाप ग्रह हो (लग्ने क्रूरः), द्वादश भाव में पाप ग्रह हो (व्यये क्रूरः), इसी प्रकार धन (द्वितीय) भाव में अशुभ ग्रह हो (धनेऽसौम्यस्तथैव च), और सप्तम भाव में पाप ग्रह हो (सप्तमे भवने क्रूरः) -- तो यह परिवार का नाश करने वाला होता है (परिवारक्षयङ्करः)।

स्रोत: BPHS Ch.10, verse 30. PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v28-31.png, clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नस्थे च गुरौ सौरौ धने राहौ तृतीयगे । इति चेज्जन्मकाले स्याद् माता तस्य न जीवति ॥ ३१ ॥

lagnasthe cha gurau saurau dhane raahau triteeyage | iti chejjanmakaale syaad maataa tasya na jeevati || 31 ||

अंग्रेज़ी अर्थ

And [if], with Jupiter situated in the ascendant (lagna-sthe cha gurau), Saturn in the 2nd house (saurau dhane), [and] Rahu in the 3rd (raahau triteeya-ge) -- if this is so (iti chet) at the time of birth (janma-kaale syaat), his/her mother (tasya maataa) does not live (na jeevati).

हिन्दी अर्थ

और यदि लग्न में गुरु स्थित हो (लग्नस्थे च गुरौ), धन भाव में शनि हो (सौरौ धने), और तृतीय भाव में राहु हो (राहौ तृतीयगे) -- यदि यह जन्म के समय हो (इति चेज्जन्मकाले स्यात्), तो उसकी (तस्य) माता जीवित नहीं रहती (माता न जीवति)।

स्रोत: BPHS Ch.10, verse 31. PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v31-33.png, clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

क्षीणचन्द्रात् त्रिकोणस्थैः पापैः सौम्यविवर्जितैः । माता परित्यजेद् वालं षण्मासाच्च न संशयः ॥ ३२ ॥

kshiinachandraat trikonasthaih paapaih saumyavivarjitaih | maataa parityajed vaalan shanmaasaachcha na sanshayah || 32 ||

अंग्रेज़ी अर्थ

[If] by malefics, devoid of benefics (paapaih saumya-vivarjitaih), situated in a trine from the waning Moon (kshiina-chandraat trikona-sthaih) [the relevant houses are afflicted] -- the mother (maataa) would abandon (parityajet) the infant (baalam) within six months (shanmaasaat cha); there is no doubt (na sanshayah).

हिन्दी अर्थ

यदि क्षीण चन्द्रमा से त्रिकोण भावों में स्थित (क्षीणचन्द्रात् त्रिकोणस्थैः) शुभ ग्रहों से रहित पाप ग्रहों से (पापैः सौम्यविवर्जितैः) [पीड़ा हो], तो माता (माता) छह मास के भीतर (षण्मासाच्च) शिशु को त्याग देती है (परित्यजेद् वालं); इसमें सन्देह नहीं है (न संशयः)।

स्रोत: BPHS Ch.10, verse 32. PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v31-33.png, clearly legible with no glyph-level ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एकांशकस्थौ मन्दारौ यत्र कुत्र स्थितौ यदा । शशि-केन्द्रगतौ तौ वा द्विमातृभ्यां न जीवति ॥ ३३ ॥

ekaanshakasthau mandaarau yatra kutra sthitau yadaa | shashi-kendragatau tau vaa dvimaatribhyaan na jeevati || 33 ||

अंग्रेज़ी अर्थ

When Saturn and Mars ('the slow one and the red one', mandaarau), situated together in one degree-portion (ekaamshaka-sthau), wherever they may be (yatra kutra sthitau) -- or (vaa) they [both] situated in a kendra from the Moon (shashi-kendra-gatau tau) -- [the child] does not live/survive [to have] two mothers (dvi-maatribhyaam na jeevati) [i.e., does not survive long enough for a second nursing-mother/stepmother -- exact idiom uncertain].

हिन्दी अर्थ

जब शनि और मंगल ("मन्द" और "आरु" [लाल] ग्रह, मन्दारौ) एक ही अंश में स्थित हों (एकांशकस्थौ), चाहे कहीं भी स्थित हों (यत्र कुत्र स्थितौ) -- अथवा (वा) दोनों चन्द्रमा से केन्द्र में स्थित हों (शशि-केन्द्रगतौ तौ) -- तो [शिशु] दो माताओं के साथ जीवित नहीं रहता (द्विमातृभ्यां न जीवति) [ठीक भावार्थ अनिश्चित]।

स्रोत: BPHS Ch.10, verse 33, closing this run of Sanskrit verses before the next Hindi commentary block (paraphrasing verses 24-33, its closing marker not yet confirmed by zoom). PDF p.107 (printed page 75). Confirmed via scratchpad/bphs-p107-v31-33.png, clearly legible with no glyph-level ambiguity, though the closing idiom "द्विमातृभ्यां न जीवति" ("does not live by/for two mothers") is somewhat elliptical in the source and its precise intended sense (the child dying before a second/step-mother could raise it, or a similar idiom) is disclosed as uncertain rather than forced to one confident reading. "मन्दारौ" ("the slow one and the red one") is a standard poetic dvandva for Saturn and Mars. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पितृकष्ट विचार-- लग्ने मन्दो मदे भौमः षष्ठस्थाने च चन्द्रमाः । इति चेज्जन्मकाले स्यात् पिता तस्य न जीवति ॥ ३४ ॥

pitrikashta vichaara-- lagne mando made bhaumah shashthasthaane cha chandramaah | iti chejjanmakaale syaat pitaa tasya na jeevati || 34 ||

अंग्रेज़ी अर्थ

Consideration of the Father's Affliction -- If (iti chet) at the time of birth (janmakaale) [it] should be (syaat) [that] Saturn ('the slow one', mandah) [is] in the ascendant (lagne), Mars (bhaumah) [is] in the position denoted 'made' [see source note], and the Moon (chandramaah) [is] in the 6th house (shashtha-sthaane), then his (tasya) father (pitaa) does not (na) live (jeevati).

हिन्दी अर्थ

पितृकष्ट विचार -- यदि (इति चेत्) जन्मकाल में (जन्मकाले) [ऐसा] हो (स्यात्) [कि] शनि ('मन्दः', मन्दो) लग्न में (लग्ने), मंगल (भौमः) 'मदे' पद से सूचित स्थान में [देखें स्रोत-टिप्पणी], और चन्द्रमा (चन्द्रमाः) षष्ठ स्थान में (षष्ठस्थाने) हों, तो उसका (तस्य) पिता (पिता) नहीं (न) जीता (जीवति)।

स्रोत: BPHS Ch.10, verse 34, opening the new subsection heading "पितृकष्ट विचार" (consideration of the father's affliction), directly following the Hindi commentary's closing marker "॥ २४-३३ ॥" for the preceding मातृकष्ट subsection. Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.108 (printed page ७६). Line 1 read from scratchpad/bphs-p108-v34-35.png; line 2 read from scratchpad/bphs-p108-v34-35b.png (both clearly legible). AMBIGUITY DISCLOSED: line 1's second locative term is printed clearly as "मदे", which is not a standard classical term for a house-position; however the immediately following (untranscribed) Hindi commentary on this page glosses the verse as "लग्न में शनि, सप्तम भाव में भौम, और षष्ठ स्थान में चन्द्रमा" (Saturn in lagna, Mars in the 7th house, Moon in the 6th house), implying the commentator reads "मदे" as denoting the 7th house -- a correspondence not independently verified by the transcriber; the printed Sanskrit "मदे" is preserved verbatim rather than silently emended to "सप्तमे". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्ने जीवो धने मन्दरविभौमबुधास्तथा । विवाहसमये तस्य बालस्य म्रियते पिता ॥ ३५ ॥

lagne jeevo dhane mandaravibhaumabudhaastathaa | vivaahasamaye tasya baalasya mriyate pitaa || 35 ||

अंग्रेज़ी अर्थ

[If] Jupiter (jeevah) [is] in the ascendant (lagne), and likewise (tathaa) Saturn, the Sun, Mars, and Mercury (mandara-vi-bhauma-budhaah) together (are) in the 2nd/wealth house (dhane), [then] at the time of that child's (tasya baalasya) marriage (vivaaha-samaye), the father (pitaa) dies (mriyate).

हिन्दी अर्थ

[यदि] गुरु (जीवो) लग्न में (लग्ने) हो, और साथ ही (तथा) शनि, सूर्य, मंगल और बुध (मन्दरविभौमबुधाः) एक साथ धन-स्थान में (धने) हों, [तो] उस बालक के (तस्य बालस्य) विवाह के समय (विवाहसमये) पिता (पिता) मर जाता है (म्रियते)।

स्रोत: BPHS Ch.10, verse 35, continuing directly after verse 34 within the "पितृकष्ट विचार" subsection. PDF p.108 (printed page ७६). Read from scratchpad/bphs-p108-v34-35b.png (both lines clearly legible, ending in the verse-34-35 commentary block's opening line, confirming this is the final verse before Hindi prose). The compound "मन्दरविभौमबुधास्तथा" is parsed as मन्द(Saturn)+रवि(Sun)+भौम(Mars)+बुधाः(Mercury, pl.)+तथा(likewise) -- this reading is directly corroborated by the immediately following (untranscribed) Hindi commentary's own gloss "लग्न में गुरु, धन स्थान में शनि, रवि, मंगल और बुध" (Jupiter in lagna; Saturn, Sun, Mars, and Mercury in the wealth-house), which matches exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सूर्यः पापेन संयुक्तः पापमध्यगतोऽपि वा । सूर्यात्सप्तमगः पापस्तदा पितृवधो भवेत् ॥ ३६ ॥

sooryah paapena sanyuktah paapamadhyagato'pi vaa | sooryaatsaptamagah paapastadaa pitrivadho bhavet || 36 ||

अंग्रेज़ी अर्थ

[If] the Sun (sooryah) [is] conjoined (sanyuktah) with a malefic (paapena), or (vaa) even (api) situated between [two] malefics (paapa-madhya-gatah), [or if] a malefic (paapah) [is] in the 7th from the Sun (sooryaat saptamagah), then (tadaa) the killing/destruction of the father (pitri-vadhah) occurs (bhavet).

हिन्दी अर्थ

[यदि] सूर्य (सूर्यः) पापग्रह से युक्त (पापेन संयुक्तः) हो, या (वा) दो पापग्रहों के मध्य (पापमध्यगतः) भी (अपि) हो, [या यदि] सूर्य से सप्तम स्थान में (सूर्यात्सप्तमगः) पापग्रह (पापः) हो, तब (तदा) पिता का नाश/वध (पितृवधः) होता है (भवेत्)।

स्रोत: BPHS Ch.10, verse 36. PDF p.108 (printed page ७६). Line 1 read from scratchpad/bphs-p108-v39-bottom.png's preceding crop scratchpad/bphs-p108-v36-line1.png; line 2 read from scratchpad/bphs-p108-v36-39.png (both clearly legible). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सप्तमे भवने सूर्यः कर्मस्थो भूमिनन्दनः । राहुव्यये च यस्यैव पिता कष्टेन जीवति ॥ ३७ ॥

saptame bhavane sooryah karmastho bhoominandanah | raahuvyaye cha yasyaiva pitaa kashtena jeevati || 37 ||

अंग्रेज़ी अर्थ

[If] the Sun (sooryah) [is] in the 7th house (saptame bhavane), Mars (bhoomi-nandanah, "son of the earth") [is] in the 10th/karma house (karma-sthah), and (cha) Rahu (raahu) [is] in the 12th house (vyaye), then of that person (yasya eva), the father (pitaa) lives (jeevati) with hardship (kashtena).

हिन्दी अर्थ

[यदि] सूर्य (सूर्यः) सप्तम भवन में (सप्तमे भवने), मंगल (भूमिनन्दनः, "पृथ्वी-पुत्र") कर्म-स्थान में (कर्मस्थो), और (च) राहु (राहु) व्यय (बारहवें) स्थान में (व्यये) हों, तो जिसके [जन्मकुंडली में ऐसा हो] (यस्यैव), उसका पिता (पिता) कष्ट के साथ (कष्टेन) जीता है (जीवति)।

स्रोत: BPHS Ch.10, verse 37. PDF p.108 (printed page ७६). Read from scratchpad/bphs-p108-v36-39.png, fully legible in both lines. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

दशमस्थो यदा भौमः शत्रुक्षेत्र-समाश्रितः । म्रियते तस्य जातस्य पिता शीघ्रं न संशयः ॥ ३८ ॥

dashamastho yadaa bhaumah shatrukshetra-samaashritah | mriyate tasya jaatasya pitaa sheeghran na sanshayah || 38 ||

अंग्रेज़ी अर्थ

When (yadaa) Mars (bhaumah) [is] situated in the 10th house (dashama-sthah), resorting to an enemy's sign (shatru-kshetra-samaashritah), the father (pitaa) of that person born (tasya jaatasya) dies (mriyate) quickly (sheeghram); there is no (na) doubt (sanshayah).

हिन्दी अर्थ

जब (यदा) मंगल (भौमः) दशम भाव में स्थित (दशमस्थो) होकर शत्रु की राशि का आश्रय ले (शत्रुक्षेत्र-समाश्रितः), तो उस जातक का (तस्य जातस्य) पिता (पिता) शीघ्र (शीघ्रं) मर जाता है (म्रियते); इसमें कोई (न) संशय (संशयः) नहीं है।

स्रोत: BPHS Ch.10, verse 38. PDF p.108 (printed page ७६). Read from scratchpad/bphs-p108-v36-39.png, fully legible in both lines. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रिपुस्थाने यदा चन्द्रो लग्नस्थाने शनैश्वरः । कुजश्च सप्तमे स्थाने पिता तस्य न जीवति ॥ ३९ ॥

ripusthaane yadaa chandro lagnasthaane shanaishvarah | kujashcha saptame sthaane pitaa tasya na jeevati || 39 ||

अंग्रेज़ी अर्थ

When (yadaa) the Moon (chandrah) [is] in the enemy's house (ripu-sthaane, the 6th house), Saturn (shanaishvarah) [is] in the ascendant (lagna-sthaane), and (cha) Mars (kujah) [is] in the 7th house (saptame sthaane), that person's (tasya) father (pitaa) does not (na) live (jeevati).

हिन्दी अर्थ

जब (यदा) चन्द्रमा (चन्द्रो) शत्रु-स्थान (रिपुस्थाने, षष्ठ भाव) में, शनि (शनैश्वरः) लग्न में (लग्नस्थाने), और (च) मंगल (कुजः) सप्तम स्थान में (सप्तमे स्थाने) हों, तो उसका (तस्य) पिता (पिता) नहीं (न) जीता (जीवति)।

स्रोत: BPHS Ch.10, verse 39, closing this run of verses on this page before further Hindi commentary. PDF p.108 (printed page ७६). Read from scratchpad/bphs-p108-v39-bottom.png, fully legible in both lines (a faint CC-0/eGangotri digitization watermark overlaps the lower commentary text but not the verse itself). Corrects a lower-resolution overview-only tentative reading of the second line's first word from "कुलश्च" to the confirmed "कुजश्च" ("and Mars", from kuja). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भौमांशकगते भानौ सौरिणा च निरीक्षिते । प्राग् जन्मनो निवृत्तिः स्वान्मृत्युर्वाऽपि शिशोः पितुः ॥ ४० ॥

bhaumaanshakagate bhaanau saurinaa cha nireekshite | praag janmano nivrittih svaanmrityurvaa'pi shishoh pituh || 40 ||

अंग्रेज़ी अर्थ

[If] the Sun (bhaanau) [is] situated in Mars' navamsha (bhauma-anshaka-gate) and (cha) aspected (nireekshite) by Saturn (saurinaa), [there is,] prior to (praag) the birth (janmanah), either withdrawal/estrangement [of the father, i.e. renunciation] (nivrittih) or (vaa) even (api) death (mrityuh) of the infant's (shishoh) father (pituh).

हिन्दी अर्थ

[यदि] सूर्य (भानौ) मंगल के नवांश में स्थित (भौमांशकगते) हो और (च) शनि (सौरिणा) से दृष्ट (निरीक्षिते) हो, तो जन्म से पहले (प्राग् जन्मनो) ही शिशु के पिता का या तो वैराग्य/त्याग (निवृत्तिः) या (वा) मृत्यु (स्वान्मृत्युः) भी (अपि) हो जाता है।

स्रोत: BPHS Ch.10, verse 40. Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.109 (printed page ७७, header "अरिष्टविवेचनाध्यायः"), directly after the Hindi commentary's closing marker "॥ ३६-३९ ॥". Line 1 read from scratchpad/bphs-p109-v40-line1.png; line 2 from scratchpad/bphs-p109-v40.png (both clearly legible). The following (untranscribed) Hindi commentary glosses "निवृत्तिः" as "विरक्त होकर गृहत्यागी" (becoming detached and renouncing the household), confirming the reading. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पाताले चाम्बरे पापौ द्वादशे च यदा स्थितौ । पितरं मातरं हत्वा देशादेशान्तरं व्रजेत् ॥ ४१ ॥

paataale chaambare paapau dvaadashe cha yadaa sthitau | pitaran maataran hatvaa deshaadeshaantaran vrajet || 41 ||

अंग्रेज़ी अर्थ

When (yadaa) two malefics (paapau) are situated (sthitau) in the nadir/4th house (paataale) and (cha) the zenith/10th house (ambare), or in the 12th (dvaadashe), [the child,] having lost (hatvaa) father (pitaram) [and] mother (maataram), goes (vrajet) wandering from one land to another (desha-adesha-antaram).

हिन्दी अर्थ

जब (यदा) दो पापग्रह (पापौ) पाताल/चतुर्थ भाव में (पाताले) और (च) अम्बर/दशम भाव में (चाम्बरे), अथवा द्वादश भाव में (द्वादशे) स्थित (स्थितौ) हों, तो [जातक] पिता (पितरं) और माता (मातरं) को खोकर (हत्वा) एक देश से दूसरे देश में (देशादेशान्तरं) भटकता फिरता है (व्रजेत्)।

स्रोत: BPHS Ch.10, verse 41. PDF p.109 (printed page ७७). Read from scratchpad/bphs-p109-v41-42.png, both lines clearly legible. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राहुजीवौ रिपुक्षेत्रे लग्ने वाऽथ चतुर्थके । वत्सरे तु त्रयोविंशे पुत्रस्तातं न पश्यति ॥ ४२ ॥

raahujeevau ripukshetre lagne vaa'tha chaturthake | vatsare tu trayovinshe putrastaatan na pashyati || 42 ||

अंग्रेज़ी अर्थ

[If] Rahu and Jupiter (raahu-jeevau) [are] in the 6th/enemy house (ripu-kshetre), or (vaa) then (atha) in the ascendant (lagne) or the 4th house (chaturthake), then (tu) in his twenty-third (trayovinshe) year (vatsare), the son (putrah) does not (na) see (pashyati) [his] father (taatam).

हिन्दी अर्थ

[यदि] राहु और गुरु (राहुजीवौ) शत्रु-भाव/षष्ठ स्थान में (रिपुक्षेत्रे), या (वा) फिर (अथ) लग्न में (लग्ने) या चतुर्थ स्थान में (चतुर्थके) हों, तो (तु) अपने तेईसवें (त्रयोविंशे) वर्ष में (वत्सरे) पुत्र (पुत्रः) पिता को (तातं) नहीं (न) देख पाता (पश्यति)।

स्रोत: BPHS Ch.10, verse 42. PDF p.109 (printed page ७७). Read from scratchpad/bphs-p109-v41-42.png, both lines clearly legible. The following (untranscribed) Hindi commentary confirms "राहु और गुरु लग्न, चतुर्थ या षष्ठ स्थान में हों तो जातक के पिता की मृत्यु उसके २३वें वर्ष में हो जाती है", matching this reading. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भानुः पिता च जन्तूनां चन्द्रो माता तथैव च । पापदृष्टियुतो भानुः पापमध्यगतोऽपि वा ॥ ४३ ॥

bhaanuh pitaa cha jantoonaan chandro maataa tathaiva cha | paapadrishtiyuto bhaanuh paapamadhyagato'pi vaa || 43 ||

अंग्रेज़ी अर्थ

The Sun (bhaanuh) [is] the father (pitaa) of [all] creatures (jantoonaam), and (cha) likewise (tathaa eva) the Moon (chandrah) [is] the mother (maataa); [if] the Sun (bhaanuh) [is] joined with a malefic's aspect (paapa-drishti-yutah), or (vaa) even (api) situated between [two] malefics (paapa-madhya-gatah) [it endangers the father].

हिन्दी अर्थ

सूर्य (भानुः) [समस्त] प्राणियों का (जन्तूनां) पिता (पिता) है और (च) उसी प्रकार (तथैव) चन्द्रमा (चन्द्रो) माता (माता) है; [यदि] सूर्य (भानुः) पापग्रह की दृष्टि से युक्त (पापदृष्टियुतः) हो, या (वा) दो पापग्रहों के मध्य (पापमध्यगतः) भी (अपि) हो, [तो पिता को कष्ट होता है]।

स्रोत: BPHS Ch.10, verse 43, opening a general principle (Sun=father, Moon=mother significators) applied through verse 45. PDF p.109 (printed page ७७). Read from scratchpad/bphs-p109-v43-45c.png, both lines clearly legible. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पित्रऽरिष्टं विजानीयाच्छिशोर्जातस्य निश्चितम् । भानोः षष्ठाष्टमस्थैः पापैः सौम्यविवर्जितैः । चतुर्थस्थानगैर्वापि पित्रऽरिष्टं विनिर्दिशेत् ॥ ४४ ॥

pitr-arishtan vijaaneeyaacchishorjaatasya nishchitam | bhaanoh shashthaashtamasthaih paapaih saumyavivarjitaih | chaturthasthaanagairvaapi pitr-arishtan vinirdishet || 44 ||

अंग्रेज़ी अर्थ

One should definitely (nishchitam) know (vijaaneeyaat) the father's affliction (pitr-arishtam) for the newborn child (shishoh jaatasya) by malefics (paapaih) situated in the 6th and 8th (shashtha-ashtama-sthaih) from the Sun (bhaanoh), devoid of benefic [aspect] (saumya-vivarjitaih), or (vaa) even (api) [by malefics] situated in the 4th house (chaturtha-sthaana-gaih) -- [by these] one should specifically indicate (vinirdishet) the father's affliction (pitr-arishtam).

हिन्दी अर्थ

सूर्य से (भानोः) षष्ठ और अष्टम स्थान में (षष्ठाष्टमस्थैः) स्थित, शुभ दृष्टि से रहित (सौम्यविवर्जितैः) पापग्रहों (पापैः) से, या (वा) चतुर्थ स्थान में स्थित [पापग्रहों] से भी (अपि), नवजात शिशु के लिए (शिशोर्जातस्य) पिता की पीड़ा (पित्ररिष्टं) निश्चित रूप से (निश्चितम्) जाननी चाहिए (विजानीयात्) -- इसी से पिता की पीड़ा (पित्ररिष्टं) का विशेष रूप से निर्देश करे (विनिर्दिशेत्)।

स्रोत: BPHS Ch.10, verse 44, an unusually long three-line (six-pada) verse. PDF p.109 (printed page ७७). Lines read from scratchpad/bphs-p109-v43-45c.png (lines 1-2) and scratchpad/bphs-p109-v44-45d.png (line 3, sharper). TWO AMBIGUITIES DISCLOSED: (1) the printed text shows "पित्रऽरिष्टं" with an avagraha (ऽ) rather than the expected sandhi form "पित्ररिष्टं"/"पित्रोरिष्टं" for pitri+arishtam ("father's affliction") -- preserved verbatim as printed rather than silently normalized. (2) line 3's final verb was printed with an initial matra that could be read as either "नि" (giving the non-standard "निनिर्दिशेत्") or "वि" (giving the standard, well-attested causative-optative "विनिर्दिशेत्", "one should specifically declare") -- the grammatically valid "विनिर्दिशेत्" is adopted. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एवमिन्दोः स्थितैस्तैर्मातृकष्टं विचिन्तयेत् । कष्टं मृतिं वा जानीयाद् बलाबल-विवेकतः ॥ ४५ ॥ इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे अरिष्टविवेचनाध्यायः समाप्तः ॥ १० ॥

evamindoh sthitaistairmaatrikashtan vichintayet | kashtan mritin vaa jaaneeyaad balaabala-vivekatah || 45 || iti savimarsha-sudhaavyaakhyopete brihatpaaraasharahoraashaastre arishtavivechanaadhyaayah samaaptah || 10 ||

अंग्रेज़ी अर्थ

Thus (evam), by those same [malefics] (taih) situated (sthitaih) relative to the Moon (indoh), one should consider (vichintayet) the mother's hardship (maatri-kashtam); one should know (jaaneeyaat) [whether it results in] hardship (kashtam) or (vaa) death (mritim) by discerning (vivekatah) [the planets'] strength or weakness (bala-abala). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion (savimarshe-sudhaa-vyaakhya), the chapter discerning danger to life (arishta-vivechana-adhyaayah) is concluded (samaaptah). Chapter 10.

हिन्दी अर्थ

इस प्रकार (एवम्) चन्द्रमा से (इन्दोः) संबंधित उन्हीं [पापग्रहों] (तैः) की स्थिति (स्थितैः) से माता के कष्ट (मातृकष्टं) का विचार करना चाहिए (विचिन्तयेत्); [ग्रहों के] बल-अबल के विवेक से (बलाबल-विवेकतः) यह जानना चाहिए (जानीयात्) कि [परिणाम] कष्ट (कष्टं) है या (वा) मृत्यु (मृतिं)। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में अरिष्ट-विवेचन अध्याय (अरिष्टविवेचनाध्यायः) समाप्त (समाप्तः) होता है। अध्याय १०।

स्रोत: BPHS Ch.10, verse 45, closing this run of verses before further Hindi commentary. PDF p.109 (printed page ७७). Read from scratchpad/bphs-p109-v44-45d.png and the zoomed crop scratchpad/bphs-p109-v45-line1-zoom.png. AMBIGUITY DISCLOSED: line 1's compound was printed with a character that could be read as either "रैः" or "तैः" before "मातृकष्टं"; "तैः" ("by those [same malefics]", referring back to verse 44's criteria applied now to the Moon) is grammatically coherent and parallel in structure to verse 44, whereas "रैः" does not parse -- "तैः" is adopted. English/Hindi meanings by Vedic Hora -- for review. Chapter 10's closing colophon ("इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे अरिष्टविवेचनाध्यायः समाप्तः ॥ १० ॥") is appended to this verse per the same convention used for chapter-opening titles (cf. verse 9.32's appended colophon, verse 10.1's prefixed title). Read from PDF p.110 (printed page ७८), scratchpad/bphs-p110-colophon2.png -- clearly legible, confirming this chapter is titled "अरिष्टविवेचनाध्यायः" (matching the opening title at verse 10.1) and closes at 45 verses. The colophon is immediately preceded (on the same page) by an extensive editorial "विमर्श" (critical discussion) section by editor Devchandra Jha comparing this chapter's treatment of birth-afflictions against parallel verses in other classical works (Varahamihira's Laghujataka, etc.) -- this editorial discussion and its quoted comparison verses from OTHER texts are excluded from transcription per copyright-safety discipline (modern editorial commentary, not original BPHS root verses).

संस्कृत

अथाऽरिष्टभङ्गाध्यायः ॥ ११ ॥ पराशर उवाच-- इत्युक्तं तु मयाऽरिष्टं तद्भङ्गं शृण्वतः परम् । रिष्टं, भङ्गं च दृष्ट्वैव जातकस्य फलं दिशेत् ॥ १ ॥

athaa'rishtabhangaadhyaayah || 11 || paraashara uvaacha-- ityuktan tu mayaa'rishtan tadbhangan shrinvatah param | rishtan, bhangan cha drishtvaiva jaatakasya phalan dishet || 1 ||

अंग्रेज़ी अर्थ

[Chapter 11: The chapter on the cancellation of afflictions.] Parashara said -- Thus (iti) danger to life (arishtam) has been declared (uktam) by me (mayaa); now (tu), O [Maitreya,] listening (shrinvatah), [hear] its cancellation (tad-bhangam) further/thereafter (param). Having seen (drishtvaa eva) both the danger (rishtam) and (cha) the cancellation (bhangam), one should declare (dishet) the result (phalam) for the newborn (jaatakasya).

हिन्दी अर्थ

[अध्याय ११: अरिष्ट-भंग अध्याय।] पराशर ने कहा -- इस प्रकार (इति) मेरे द्वारा (मया) अरिष्ट (आयु-हानि) (अरिष्टं) कहा गया (उक्तं); अब (तु) सुनते हुए (शृण्वतः) [हे मैत्रेय,] उसके भंग (तद्भङ्गं) को आगे (परम्) [सुनो]। अरिष्ट (रिष्टं) और (च) भंग (भङ्गं) दोनों को देखकर ही (दृष्ट्वैव) जातक का (जातकस्य) फल (फलं) कहना चाहिए (दिशेत्)।

स्रोत: BPHS Chapter 11 opening: title "अथाऽरिष्टभङ्गाध्यायः ॥ ११ ॥" ("the chapter on the cancellation of afflictions"), invocation "पराशर उवाच--", and verse 1, prefixed per the established chapter-opening convention (cf. verses 9.1, 10.1). Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.110 (printed page ७८), immediately following Chapter 10's colophon and the ornamental section-divider. Read from scratchpad/bphs-p110-ch11title.png (title, invocation) and scratchpad/bphs-p110-v1-2.png (verse 1, both lines clearly legible). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एकोऽपि ज्ञार्यशुक्राणां लग्नात् केन्द्रगतो यदि । अरिष्टं निखिलं हन्ति तिमिरं भास्करो यथा ॥ २ ॥

eko'pi jnyaaryashukraanaan lagnaat kendragato yadi | arishtan nikhilan hanti timiran bhaaskaro yathaa || 2 ||

अंग्रेज़ी अर्थ

If (yadi) even one (ekah api) of Mercury, Jupiter, and Venus (jnya-aarya-shukraanaam) [is] situated in a kendra (kendragatah) from the ascendant (lagnaat), it destroys (hanti) all affliction (arishtam nikhilam) entirely, just as (yathaa) the Sun (bhaaskarah) [destroys] darkness (timiram).

हिन्दी अर्थ

यदि (यदि) बुध, गुरु और शुक्र (ज्ञार्यशुक्राणां) में से एक (एकोऽपि) भी लग्न से (लग्नात्) केन्द्र में स्थित (केन्द्रगतः) हो, तो वह समस्त (निखिलं) अरिष्ट (अरिष्टं) को उसी प्रकार नष्ट कर देता है (हन्ति) जैसे (यथा) सूर्य (भास्करो) अन्धकार (तिमिरं) को [नष्ट कर देता है]।

स्रोत: BPHS Ch.11, verse 2. PDF p.110 (printed page ७८). Read from scratchpad/bphs-p110-v1-2.png and the higher-resolution watermark-free crop scratchpad/bphs-p110-v2-line1-zoom2.png (extracted directly from the PDF's embedded scan image via PyMuPDF's page.get_images()/fitz.Pixmap(doc, xref), bypassing the page's overlaid CC-0/eGangotri vector-text watermark entirely -- a new, more reliable technique than cropping the rendered page, adopted here after the watermark was found to obscure verse 3 below). AMBIGUITY DISCLOSED: the compound's middle member is printed clearly as "आर्य" ("aarya", lit. "noble one"), which is not the most common classical name for Jupiter (usually "गुरु", "जीव", or "इज्य"); however "आर्य" ("the venerable one") is an attested honorific epithet for Jupiter as preceptor of the gods, and this reading is required by the verse's grammar ("एकोऽपि", "even one of [these]", genitive plural "ज्ञार्यशुक्राणाम्") and its evident sense of naming the three classical benefics (Mercury, Jupiter, Venus) as a group -- preserved verbatim as printed rather than emended to a more familiar epithet. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एक एव बली जीवो लग्नस्थोऽरिष्टसंचयम् । हन्ति पापत्रयं भक्त्या प्रणामं इव शूलिनः ॥ ३ ॥

eka eva balee jeevo lagnastho'rishtasanchayam | hanti paapatrayan bhaktyaa pranaaman iva shoolinah || 3 ||

अंग्रेज़ी अर्थ

A single (ekah eva) strong (balee) Jupiter (jeevah), situated in the lagna (lagna-sthah), destroys (hanti) the accumulation of afflictions (arishta-sanchayam) -- just as (iva) a devoted (bhaktyaa) prostration (pranaamam) [destroys] the three-fold sin (paapa-trayam) [before] the Trident-Bearer (shoolinah, an epithet of Shiva).

हिन्दी अर्थ

एक (एक एव) बलवान (बली) गुरु (जीवो), लग्न में स्थित (लग्नस्थः), समस्त संचित अरिष्ट (अरिष्टसंचयम्) को उसी प्रकार नष्ट कर देता है (हन्ति) जैसे (इव) त्रिशूलधारी शिव (शूलिनः) के प्रति भक्तिपूर्वक (भक्त्या) किया गया प्रणाम (प्रणामं) त्रिविध पाप (पापत्रयं) को [नष्ट कर देता है]।

स्रोत: BPHS Ch.11, verse 3, closing this run of verses before further content. PDF p.110 (printed page ७८). Line 1 read from scratchpad/bphs-p110-v3.png. Line 2 was significantly obscured on the standard page render by the page's overlaid CC-0/eGangotri digitization watermark (a real vector-text PDF span, confirmed via page.get_text('dict') to sit at PDF-space y=556-566pt, landing directly across this line at 600dpi); resolved by extracting the page's embedded raster scan directly via PyMuPDF (page.get_images() -> fitz.Pixmap(doc, xref)), which excludes the separately-drawn watermark layer entirely -- read cleanly from the resulting scratchpad/bphs-p110-raw-image.png (cropped/zoomed as scratchpad/bphs-p110-v3-rawcrop.png), with no remaining ambiguity. "शूलिनः" ("the trident-bearer") is a standard epithet of Shiva. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एक एव विलग्नेशः केन्द्रसंस्थो बलान्वितः । अरिष्टं निखिलं हन्ति पिनाकी त्रिपुरं यथा ॥ ४ ॥

eka eva vilagneshah kendrasanstho balaanvitah | arishtan nikhilan hanti pinaakee tripuran yathaa || 4 ||

अंग्रेज़ी अर्थ

A single (ekah eva) lord of the ascendant (vilagna-ishah), situated in a kendra (kendra-sansthah) and endowed with strength (bala-anvitah), destroys (hanti) all affliction (arishtam nikhilam) entirely, just as (yathaa) the Trident-Bearer (pinaakee, Shiva) [destroyed] the Three Cities (Tripuram).

हिन्दी अर्थ

एक (एक एव) बलयुक्त (बलान्वितः) लग्नेश (विलग्नेशः), केन्द्र में स्थित (केन्द्रसंस्थो), समस्त (निखिलं) अरिष्ट (अरिष्टं) को उसी प्रकार नष्ट कर देता है (हन्ति) जैसे (यथा) त्रिपुरारि शिव (पिनाकी) ने त्रिपुर (त्रिपुरं) को [नष्ट किया]।

स्रोत: BPHS Ch.11, verse 4. PDF p.111 (printed page ७९), doc index 110. Read from scratchpad/bphs-p111-v4-5.png, a 3x zoom crop of scratchpad/bphs-p111-raw.png (the page's embedded raster scan extracted directly via PyMuPDF's page.get_images()/fitz.Pixmap(doc, xref), bypassing the page's overlaid CC-0/eGangotri watermark entirely). Matches the initial overview reading exactly, no ambiguity. "पिनाकी त्रिपुरं" is a standard Puranic reference: Pinaakin ("wielder of the Pinaka bow/trident", an epithet of Shiva) destroying Tripura, the Three Cities of the asuras -- read as a simile only, not independently transcribed from any other text. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

शुक्लपक्षे क्षपाजन्म-लग्ने सौम्यनिरीक्षिते । विपरीतं कृष्णपक्षे तथारिष्ट-विनाशनम् ॥ ५ ॥

shuklapakshe kshapaajanma-lagne saumyanireekshite | vipareetan krishnapakshe tathaarishta-vinaashanam || 5 ||

अंग्रेज़ी अर्थ

If birth occurs at night (kshapaa-janma) in the bright fortnight (shukla-pakshe), with the ascendant (lagne) aspected by a benefic (saumya-nireekshite) -- [the result is] reversed (vipareetam) in the dark fortnight (krishna-pakshe); thus (tathaa) is the destruction of affliction (arishta-vinaashanam) [to be understood].

हिन्दी अर्थ

यदि शुक्ल पक्ष (शुक्लपक्षे) में रात्रि में जन्म (क्षपाजन्म) हो और लग्न (लग्ने) पर शुभ ग्रह की दृष्टि (सौम्यनिरीक्षिते) हो -- तो कृष्ण पक्ष (कृष्णपक्षे) में विपरीत (विपरीतं) [स्थिति में भी]; इस प्रकार (तथा) अरिष्ट का नाश (अरिष्ट-विनाशनम्) [जानना चाहिए]।

स्रोत: BPHS Ch.11, verse 5, closing the first block of this chapter (verses 1-5). PDF p.111 (printed page ७९). Read from scratchpad/bphs-p111-v4-5.png (same crop as verse 4). Matches the initial overview reading exactly, no ambiguity. The following Hindi commentary is explicitly marked "॥ १-५ ॥", confirming it paraphrases exactly verses 1 through 5 as a unit (read for corroboration only, not transcribed: it restates that a strong lagnesh in a kendra, or the lagna aspected by a benefic under specific paksha/time conditions, cancels all arishta). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

व्ययस्थाने यदा सूर्यस्तुलालग्ने तु जायते । जीवेत् स शतवर्षाणि दीर्घायुर्बालको भवेत् ॥ ६ ॥

vyayasthaane yadaa sooryastulaalagne tu jaayate | jeevet sa shatavarshaani deerghaayurbaalako bhavet || 6 ||

अंग्रेज़ी अर्थ

When (yadaa) the Sun (sooryah) is in the 12th house (vyaya-sthaane) and [the native] is born (jaayate) with Libra as the ascendant (tulaa-lagne), he (sah) shall live (jeevet) a hundred years (shata-varshaani); the child (baalakah) shall become (bhavet) long-lived (deerghaayuh).

हिन्दी अर्थ

जब (यदा) सूर्य (सूर्यः) व्यय स्थान (बारहवें भाव) में (व्ययस्थाने) हो और तुला लग्न (तुलालग्ने) में जन्म हो (जायते), तो वह (स) सौ वर्ष (शतवर्षाणि) तक जीवित रहता है (जीवेत्); बालक (बालको) दीर्घायु (दीर्घायुः) होता है (भवेत्)।

स्रोत: BPHS Ch.11, verse 6, opening a new block on PDF p.111 (printed page ७९). Read from scratchpad/bphs-p111-v6-8.png, a 3x zoom crop of the watermark-free scratchpad/bphs-p111-raw.png. Matches the initial overview reading exactly, no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नाच्चतुर्थगः पापो गुरुः केतुत्रिकोणगः । कुलद्वयानन्दकरः स्वस्थो दीर्घायुरर्भकः ॥ ७ ॥

lagnaachchaturthagah paapo guruh ketutrikonagah | kuladvayaanandakarah svastho deerghaayurarbhakah || 7 ||

अंग्रेज़ी अर्थ

[If] a malefic (paapah) is in the 4th house (chaturtha-gah) from the ascendant (lagnaat), [and] Jupiter (guruh) is in trine to Ketu (ketu-trikona-gah), the child (arbhakah) is healthy (svasthah) [and] long-lived (deerghaayuh), bringing joy to both families (kula-dvaya-aananda-karah).

हिन्दी अर्थ

यदि लग्न से (लग्नात्) चतुर्थ भाव में (चतुर्थगः) पाप ग्रह (पापो) हो, और गुरु (गुरुः) केतु से त्रिकोण में (केतुत्रिकोणगः) हो, तो बालक (अर्भकः) स्वस्थ (स्वस्थो) और दीर्घायु (दीर्घायुः) होता है, तथा दोनों कुलों को आनन्द देने वाला (कुलद्वयानन्दकरः) होता है।

स्रोत: BPHS Ch.11, verse 7. PDF p.111 (printed page ७९). Line 1 read from scratchpad/bphs-p111-v6-8.png; line 2 confirmed via the sharper scratchpad/bphs-p111-v9-10.png crop (which also captured this verse's second line at its top edge). Matches the initial overview reading exactly, no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गुरुभौमौ यदा युक्तौ गुरुदृष्टोऽथवा कुजः । हत्वाऽरिष्टमशेषं च जनन्याः शुभकृद् भवेत् ॥ ८ ॥

gurubhaumau yadaa yuktau gurudrishto'thavaa kujah | hatvaa'rishtamasheshan cha jananyaah shubhakrid bhavet || 8 ||

अंग्रेज़ी अर्थ

When (yadaa) Jupiter and Mars (guru-bhaumau) are conjoined (yuktau), or (athavaa) Mars (kujah) is aspected by Jupiter (guru-drishtah), having destroyed (hatvaa) the entirety (ashesham) of affliction (arishtam), [that combination] becomes (bhavet) auspicious (shubha-krit) for the mother (jananyaah).

हिन्दी अर्थ

जब (यदा) गुरु और मंगल (गुरुभौमौ) युक्त (युक्तौ) हों, अथवा (अथवा) मंगल (कुजः) गुरु से दृष्ट (गुरुदृष्टः) हो, तो समस्त (अशेषं) अरिष्ट (अरिष्टं) को नष्ट करके (हत्वा) [यह योग] माता (जनन्याः) के लिए शुभकारक (शुभकृद्) होता है (भवेत्)।

स्रोत: BPHS Ch.11, verse 8, closing this block before the next Hindi commentary. PDF p.111 (printed page ७९). Read from scratchpad/bphs-p111-v6-8.png and confirmed against scratchpad/bphs-p111-v9-10.png. Matches the initial overview reading exactly, no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुर्थे दशमे पापः सौम्यमध्ये यदा भवेत् । पितुः सौख्यकरो योगः शुभैः केन्द्रत्रिकोणगैः ॥ ९ ॥

chaturthe dashame paapah saumyamadhye yadaa bhavet | pituh saukhyakaro yogah shubhaih kendratrikonagaih || 9 ||

अंग्रेज़ी अर्थ

When (yadaa) a malefic (paapah) in the 4th or 10th house (chaturthe dashame) comes to be (bhavet) flanked by benefics (saumya-madhye), [that] combination (yogah), together with benefics (shubhaih) situated in kendras and trikonas (kendra-trikona-gaih), brings well-being to the father (pituh saukhya-karah).

हिन्दी अर्थ

जब (यदा) चतुर्थ या दशम भाव में (चतुर्थे दशमे) पाप ग्रह (पापः) शुभ ग्रहों के मध्य (सौम्यमध्ये) हो (भवेत्), [तो] केन्द्र और त्रिकोण में स्थित (केन्द्रत्रिकोणगैः) शुभ ग्रहों (शुभैः) के साथ यह योग (योगः) पिता (पितुः) के लिए सुखकारक (सौख्यकरो) होता है।

स्रोत: BPHS Ch.11, verse 9. PDF p.111 (printed page ७९). Read from scratchpad/bphs-p111-v9-10.png, a 3x zoom crop of the watermark-free scratchpad/bphs-p111-raw.png, and confirmed again via scratchpad/bphs-p111-v10-full.png. Matches the initial overview reading exactly, no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सौम्यान्तरगतैः पापैः शुभैः केन्द्रत्रिकोणगैः । सद्यो नाशयतेऽरिष्टं तद्भावोत्थफलं न तत् ॥ १० ॥ इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे अरिष्टभङ्गाध्यायः समाप्तः ॥ ११ ॥

saumyaantaragataih paapaih shubhaih kendratrikonagaih | sadyo naashayate'rishtan tadbhaavotthaphalan na tat || 10 || iti savimarsha-sudhaavyaakhyopete brihatpaaraasharahoraashaastre arishtabhangaadhyaayah samaaptah || 11 ||

अंग्रेज़ी अर्थ

By malefics (paapaih) situated between benefics (saumya-antara-gataih), together with benefics (shubhaih) situated in kendras and trikonas (kendra-trikona-gaih), affliction (arishtam) is destroyed (naashayate) instantly (sadyah); that (tat) is not (na) [merely] the result (phalam) arising from that house (tad-bhaava-uttham) [that would otherwise be expected]. [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion (savimarshe-sudhaa-vyaakhya), the chapter on the cancellation of afflictions (arishta-bhanga-adhyaayah) is concluded (samaaptah). Chapter 11.

हिन्दी अर्थ

शुभ ग्रहों के मध्य स्थित (सौम्यान्तरगतैः) पाप ग्रहों (पापैः) के साथ, केन्द्र और त्रिकोण में स्थित (केन्द्रत्रिकोणगैः) शुभ ग्रहों (शुभैः) द्वारा, अरिष्ट (अरिष्टं) तुरन्त (सद्यो) नष्ट हो जाता है (नाशयते); वह (तत्) उस भाव से उत्पन्न होने वाला (तद्भावोत्थ) [सामान्य अशुभ] फल (फलं) नहीं (न) है। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में अरिष्ट-भंग अध्याय (अरिष्टभङ्गाध्यायः) समाप्त (समाप्तः) होता है। अध्याय ११।

स्रोत: BPHS Ch.11, verse 10, closing this block. PDF p.111 (printed page ७९). Read from scratchpad/bphs-p111-v10-full.png, a dedicated 3x zoom crop of scratchpad/bphs-p111-raw.png generated after the initial scratchpad/bphs-p111-v9-10.png crop cut off partway through this verse's second line. Matches the initial overview reading exactly, no ambiguity. The Hindi commentary immediately following (not transcribed, read for corroboration only) explicitly discusses verses 6-10 together via a Libra-ascendant/12th-house-Sun worked example and a list of benefic house-positions (1,4,7,10,9,5), confirming the verse boundary and general sense. English/Hindi meanings by Vedic Hora -- for review. Chapter 11's closing colophon ("इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे अरिष्टभङ्गाध्यायः समाप्तः ॥ ११ ॥") is appended to this verse per the established convention (cf. verse 10.45's appended colophon). Read from PDF p.112 (doc index 111, printed page ८०), scratchpad/bphs-p112-colophon.png -- clearly legible, confirming this chapter is titled "अरिष्टभङ्गाध्यायः" (matching the opening title at verse 11.1) and closes at exactly 10 verses. The preceding Hindi commentary line is marked "॥ ६-१० ॥", confirming it paraphrases verses 6 through 10 as a unit (read for corroboration only, not transcribed).

संस्कृत

अथ भावविवेचनाध्यायः ॥ १२ ॥ मैत्रेय उवाच-- श्रुतं रिष्टं च तद्भङ्गं भगवन् भवतोदितम् । अथ किं किं कुतो भावाद् विचार्यमिति कथ्यताम् ॥ १ ॥

atha bhaavavivechanaadhyaayah || 12 || maitreya uvaacha-- shrutan rishtan cha tadbhangan bhagavan bhavatoditam | atha kin kin kuto bhaavaad vichaaryamiti kathyataam || 1 ||

अंग्रेज़ी अर्थ

[Chapter 12: The chapter on the discernment of the houses (bhavas).] Maitreya said -- Danger to life (rishtam) and (cha) its cancellation (tad-bhangam) have been heard (shrutam), O venerable one (bhagavan), as declared (uditam) by you (bhavataa). Now (atha), what and what (kim kim) is to be examined (vichaaryam) from which house (kutah bhaavaat) -- let this be told (kathyataam iti).

हिन्दी अर्थ

[अध्याय १२: भाव-विवेचन अध्याय।] मैत्रेय ने कहा -- हे भगवन् (भगवन्), आपके द्वारा (भवता) कहा गया (उदितम्) अरिष्ट (रिष्टं) और (च) उसका भंग (तद्भङ्गं) सुना (श्रुतं) गया। अब (अथ) किस-किस भाव से (कुतो भावाद्) क्या-क्या (किं किं) विचार करना चाहिए (विचार्यम्), यह कहिए (कथ्यताम् इति)।

स्रोत: BPHS Chapter 12 opening: title "अथ भावविवेचनाध्यायः ॥ १२ ॥" ("the chapter on the discernment of the houses/bhavas"), invocation "मैत्रेय उवाच--" (unusually, this chapter opens with Maitreya's question rather than Parashara's speech), and verse 1, prefixed per the established chapter-opening convention. Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.112 (doc index 111, printed page ८०), immediately following Chapter 11's colophon and the ornamental section-divider. Read from scratchpad/bphs-p112-title2-v1.png and scratchpad/bphs-p112-v2-3b.png (both lines clearly legible), extracted from the page's watermark-free embedded raster image scratchpad/bphs-p112-raw.png via PyMuPDF's page.get_images()/fitz.Pixmap(doc, xref). The following Hindi commentary paraphrases this verse as Maitreya's question, then an editorial subheading "तन्वादि भावों से विचारणीय विषय--" ("topics to be examined from the 1st house onward") introduces the answer -- both read for context only, not transcribed (editorial signposting, not root verse). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पराशर उवाच-- तनुं रूपं च ज्ञानं च वर्णं चैव बलाऽबलम् । प्रकृतिं सुख-दुःखं च तनुभावाद् विचिन्तयेत् ॥ २ ॥

paraashara uvaacha-- tanun roopan cha jnyaanan cha varnan chaiva balaa'balam | prakritin sukha-duhkhan cha tanubhaavaad vichintayet || 2 ||

अंग्रेज़ी अर्थ

Parashara said -- The body (tanum), appearance (roopam), knowledge (jnyaanam), complexion (varnam), and strength-and-weakness (bala-abalam), disposition (prakritim), and (cha) happiness and sorrow (sukha-duhkham) -- these one should examine (vichintayet) from the 1st house/body-house (tanu-bhaavaat).

हिन्दी अर्थ

पराशर ने कहा -- शरीर (तनुं), रूप (रूपं), ज्ञान (ज्ञानं), वर्ण (वर्णं), बल और अबल (बलाऽबलम्), स्वभाव (प्रकृतिं), और सुख-दुःख (सुख-दुःखं) -- इनका विचार (विचिन्तयेत्) प्रथम भाव अर्थात् तनु-भाव से (तनुभावाद्) करना चाहिए।

स्रोत: BPHS Ch.12, verse 2, opening Parashara's answer (invocation "पराशर उवाच--" prefixed per convention). PDF p.112 (printed page ८०). Read from scratchpad/bphs-p112-v4-5b.png and confirmed via the targeted zoom scratchpad/bphs-p112-v2-word-zoom3.png, which clearly resolved the compound "बलाऽबलम्" ("strength and weakness", a standard jyotish pairing) -- the lower-resolution overview had tentatively suggested "वलाऽबलम्"; the full-resolution crop confirms both consonants are ब (bala-abalam), not व. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कुटुम्बं च धनं धान्यं मृत्युजालममित्रकम् । धातुरत्नादिकं सर्वं धनस्थानान्निरीक्षयेत् ॥ ३ ॥

kutumban cha dhanan dhaanyan mrityujaalamamitrakam | dhaaturatnaadikan sarvan dhanasthaanaannireekshayet || 3 ||

अंग्रेज़ी अर्थ

Family (kutumbam), wealth (dhanam), grain (dhaanyam), the web/net of death (mrityu-jaalam), enemies (amitrakam), and metals, gems, and so forth (dhaatu-ratna-aadikam) -- all these (sarvam) one should examine (nireekshayet) from the 2nd house/wealth-house (dhana-sthaanaat).

हिन्दी अर्थ

कुटुम्ब (कुटुम्बं), धन (धनं), धान्य (धान्यं), मृत्यु का जाल (मृत्युजालम्), शत्रु (अमित्रकम्), तथा धातु-रत्न आदि (धातुरत्नादिकं) -- यह सब (सर्वं) द्वितीय भाव अर्थात् धन-स्थान से (धनस्थानान्) देखना चाहिए (निरीक्षयेत्)।

स्रोत: BPHS Ch.12, verse 3. PDF p.112 (printed page ८०). Read from scratchpad/bphs-p112-v3-4.png and confirmed via the targeted zooms scratchpad/bphs-p112-v3-line1-zoom.png and scratchpad/bphs-p112-v3-line2-zoom.png. Matches the initial overview reading, no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

विक्रमं भृत्य-भ्रात्रादि चोपदेश-प्रयाणकम् । पित्रोर्वैं मरणं विद्यान् दुश्चिक्यां च निरीक्षयेत् ॥ ४ ॥

vikraman bhritya-bhraatraadi chopadesha-prayaanakam | pitrorvain maranan vidyaan dushchikyaan cha nireekshayet || 4 ||

अंग्रेज़ी अर्थ

Valour (vikramam), servants, brothers, and so forth (bhritya-bhraatra-aadi), and counsel and travel/journeys (upadesha-prayaanakam) -- one should know (vidyaat/vidyaan) the death (maranam) of the parents (pitroh) [also from this house], and one should examine (nireekshayet) misfortune/hardship (dushchikyam) as well (cha) [from the 3rd house].

हिन्दी अर्थ

पराक्रम (विक्रमं), भृत्य-भ्राता आदि (भृत्य-भ्रात्रादि), तथा उपदेश और यात्रा (उपदेश-प्रयाणकम्) -- माता-पिता (पित्रोः) की मृत्यु (मरणं) भी इसी भाव से जाननी चाहिए (विद्यात्), और दुष्चिक्य अर्थात् दुर्भाग्य/कष्ट (दुश्चिक्यां) का भी विचार करना चाहिए (निरीक्षयेत्)।

स्रोत: BPHS Ch.12, verse 4. PDF p.112 (printed page ८०). Read from scratchpad/bphs-p112-v3-4.png and confirmed via the targeted zooms scratchpad/bphs-p112-v4-line1-zoom.png, scratchpad/bphs-p112-v4-line2-left.png, and scratchpad/bphs-p112-v4-line2-right.png. TWO AMBIGUITIES DISCLOSED: (1) the verb before "दुश्चिक्यां च निरीक्षयेत्" is printed clearly as "विद्यान्" (with anusvara/final न्), which is grammatically unusual -- the expected classical Vedic-optative form in this exact recurring phrase-pattern (cf. verse 10.44's "विनिर्दिशेत्") would be "विद्यात्"; preserved verbatim as printed ("विद्यान्") rather than silently emended, with "विद्यात्" noted as the likely intended/standard form. (2) "दुश्चिक्यां" (misfortune/hardship) is printed with a feminine accusative-looking ending (-याम्) though the expected neuter form parallel to other items in this list would be "दुश्चिक्यं"; preserved verbatim as printed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

बान्धवानथ यानानि मातृसौख्यादिकान्यपि । निधिक्षेत्र-गृहारामादिकं तुर्याद् विचारयेत् ॥ ५ ॥

baandhavaanatha yaanaani maatrisaukhyaadikaanyapi | nidhikshetra-grihaaraamaadikan turyaad vichaarayet || 5 ||

अंग्रेज़ी अर्थ

Kinsmen (baandhavaan), and (atha) vehicles (yaanaani), and mother's happiness and the like (maatri-saukhya-aadikaani api), [and] treasure, land, house, gardens, and so forth (nidhi-kshetra-griha-aaraama-aadikam) -- these one should examine (vichaarayet) from the 4th house (turyaat).

हिन्दी अर्थ

बान्धव (बान्धवान्), तथा (अथ) वाहन (यानानि), माता का सुख आदि (मातृसौख्यादिकान्यपि), तथा निधि, क्षेत्र, गृह, बगीचा आदि (निधिक्षेत्र-गृहारामादिकं) -- इनका विचार (विचारयेत्) चतुर्थ भाव से (तुर्याद्) करना चाहिए।

स्रोत: BPHS Ch.12, verse 5, closing this block before the following Hindi commentary (explicitly marked "॥ २-५ ॥", confirming it paraphrases verses 2 through 5 as a unit covering the 1st-4th houses -- read for corroboration only, not transcribed). PDF p.112 (printed page ८०). Read from scratchpad/bphs-p112-v5-actual.png. Matches the initial overview reading, no ambiguity. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

यन्त्रं मन्त्रं तथा विद्यां बुद्धेश्चैव प्रबन्धकम् । पुत्रराज्यापभ्रंशादीन् पश्येत् पुत्रालयाद् बुधः ॥ ६ ॥

yantran mantran tathaa vidyaan buddheshchaiva prabandhakam | putraraajyaapabhranshaadeen pashyet putraalayaad budhah || 6 ||

अंग्रेज़ी अर्थ

The wise (budhah) should see (pashyet) from the house of children (putra-aalayaat): yantra (mystic diagram), mantra, and (tathaa) learning (vidyaam), and (cha eva) the arrangement/continuity of the intellect (buddheh prabandhakam), [as well as] the loss/decline (apabhramsha-aadeen) of sons and kingdom (putra-raajya).

हिन्दी अर्थ

बुद्धिमान् (बुधः) व्यक्ति को पुत्र-भाव से (पुत्रालयाद्) यन्त्र (यन्त्रं), मन्त्र (मन्त्रं) तथा (तथा) विद्या (विद्यां), और (चैव) बुद्धि की निरन्तरता (बुद्धेः प्रबन्धकम्), तथा पुत्र और राज्य के नाश आदि (पुत्रराज्यापभ्रंशादीन्) को देखना चाहिए (पश्येत्)।

स्रोत: BPHS Ch.12, verse 6, opening the section on houses 5 and beyond ("पञ्चमादि भावों से विचारणीय विषय--", a Hindi editorial sub-heading, read for corroboration only, not transcribed). PDF p.113 (doc index 112, printed page ८१), header "भावविवेचनाध्यायः". Read from scratchpad/bphs-p113-v6-7.png (both lines fully legible), confirming the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मातुलं मृत्युशङ्काश्च शत्रूंश्चैव व्रणादिकान् । सपत्नीमातरं चापि शत्रुस्थानान्निरीक्षयेत् ॥ ७ ॥

maatulan mrityushankaashcha shatroonshchaiva vranaadikaan | sapatneemaataran chaapi shatrusthaanaannireekshayet || 7 ||

अंग्रेज़ी अर्थ

One should examine (nireekshayet) from the house of enemies (shatru-sthaanaat): the maternal uncle (maatulam), fears of death (mrityu-shankaah), and (cha eva) enemies (shatroon) [and] wounds etc. (vrana-aadikaan), and also (cha api) the co-wife's mother/step-mother (sapatnee-maataram).

हिन्दी अर्थ

शत्रु-भाव से (शत्रुस्थानान्) मामा (मातुलं), मृत्यु की आशंका (मृत्युशङ्काश्च), तथा (चैव) शत्रुओं (शत्रूंश्च) और व्रण आदि (व्रणादिकान्), और सौतेली माता/सपत्नी की माता (सपत्नीमातरं) को भी (चापि) देखना चाहिए (निरीक्षयेत्)।

स्रोत: BPHS Ch.12, verse 7. PDF p.113, printed page ८१. Read from scratchpad/bphs-p113-v6-7.png and scratchpad/bphs-p113-v8-9.png (line 1 visible at top), confirming the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जायामध्वप्रयाणं च पदाप्तिं च वणिक्-क्रियाम् । मरणं च स्वदेहस्य जायाभावान्निरीक्षयेत् ॥ ८ ॥

jaayaamadhvaprayaanan cha padaaptin cha vanik-kriyaam | maranan cha svadehasya jaayaabhaavaannireekshayet || 8 ||

अंग्रेज़ी अर्थ

One should examine (nireekshayet) from the house of the wife (jaayaa-bhaavaat): the wife's journey on the road (jaayaa-adhva-prayaanam), and (cha) the attainment of position/rank (pada-aaptim), and (cha) trade-dealings (vanik-kriyaam), and (cha) the death (maranam) of one's own body (sva-dehasya).

हिन्दी अर्थ

पत्नी-भाव से (जायाभावान्) पत्नी की मार्ग-यात्रा (जायामध्वप्रयाणं), और (च) पद-प्राप्ति (पदाप्तिं), और (च) वणिक्-व्यापार-क्रिया (वणिक्-क्रियाम्), और (च) अपने शरीर की मृत्यु (स्वदेहस्य मरणं) को देखना चाहिए (निरीक्षयेत्)।

स्रोत: BPHS Ch.12, verse 8. PDF p.113, printed page ८१. Line 1 zoom-confirmed via scratchpad/bphs-p113-v8-line1-zoom2.png (clearly legible: "जायामध्वप्रयाणं च पदाप्तिं च वणिक्-क्रियाम्", matching the tentative overview reading exactly after an initial lower-resolution crop had misread it); line 2 confirmed via scratchpad/bphs-p113-v8-9.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

आयुर्मृत्युपरं चापि गुदे चैवाङ्कुरादिकम् । पूर्वापर-जनुर्वृत्तं सर्वं रन्ध्राद् विचिन्तयेत् ॥ ९ ॥

aayurmrityuparan chaapi gude chaivaankuraadikam | poorvaapara-janurvrittan sarvan randhraad vichintayet || 9 ||

अंग्रेज़ी अर्थ

One should ascertain (vichintayet) from the 8th house (randhraat): matters concerning (param) longevity and death (aayuh-mrityu), and also (cha api) marks/growths etc. (ankura-aadikam) on the anus (gude), and (cha) the entire (sarvam) account of prior and later births (poorva-apara-januh-vrittam).

हिन्दी अर्थ

अष्टम भाव से (रन्ध्राद्) आयु-मृत्यु सम्बन्धी विषय (आयुर्मृत्युपरं), और (चापि) गुदा में अंकुर आदि चिह्न (गुदे चैवाङ्कुरादिकम्), और (सर्वं) पूर्व-अपर जन्मों का सम्पूर्ण वृत्तान्त (पूर्वापर-जनुर्वृत्तं) निश्चित करना चाहिए (विचिन्तयेत्)।

स्रोत: BPHS Ch.12, verse 9, closing this sub-section (Hindi commentary marks it "॥ ६-९ ॥", read for corroboration only, not transcribed -- it also contains a quoted citation from another classical text on 5th/6th/7th-house topics, excluded from transcription per copyright-safety discipline). PDF p.113, printed page ८१. Line 1 zoom-confirmed via scratchpad/bphs-p113-v9-line1-zoom2.png (matching tentative reading exactly, correcting an initial lower-resolution misreading). Line 2 zoom-confirmed via scratchpad/bphs-p113-v9-line2-zoom.png and a tighter word-level crop scratchpad/bphs-p113-v9-word-zoom.png: the compound is clearly printed "जनुर्वृत्तं" (from जनुस्, "birth/origin"), CORRECTING the initial overview-level tentative reading of "जन्मवृत्तं" -- preserved verbatim as printed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धर्मं भाग्यमथो श्यालं भ्रातृ-पत्न्यादिकांस्तथा । तीर्थयात्रादिकं सर्वं धर्मस्थानान्निरीक्षयेत् ॥ १० ॥

dharman bhaagyamatho shyaalan bhraatri-patnyaadikaanstathaa | teerthayaatraadikan sarvan dharmasthaanaannireekshayet || 10 ||

अंग्रेज़ी अर्थ

One should examine (nireekshayet) from the house of dharma/fortune (dharma-sthaanaat): dharma (dharmam), fortune (bhaagyam), and then (atho) the wife's brother (shyaalam), and (tathaa) the brother's wife etc. (bhraatri-patnee-aadikaan), and (sarvam) pilgrimage etc. (teertha-yaatraa-aadikam) entirely.

हिन्दी अर्थ

भाग्य-भाव से (धर्मस्थानान्) धर्म (धर्मं), भाग्य (भाग्यमथो), और साला/पत्नी का भाई (श्यालं), तथा (तथा) भाई की पत्नी आदि (भ्रातृ-पत्न्यादिकांस्), और सम्पूर्ण (सर्वं) तीर्थयात्रा आदि (तीर्थयात्रादिकं) को देखना चाहिए (निरीक्षयेत्)।

स्रोत: BPHS Ch.12, verse 10, opening the section on houses 9 and beyond ("नवमादि भावों से विचारणीय विषय--", Hindi editorial sub-heading, read for corroboration only, not transcribed). PDF p.113, printed page ८१. Line 1 zoom-confirmed via scratchpad/bphs-p113-v10-line1-zoom2.png; line 2 via scratchpad/bphs-p113-v10-11.png. AMBIGUITY DISCLOSED: the second word of line 1 is printed with a conjunct glyph that, at this font/resolution, visually resembles "इयालं" as much as "श्यालं" (both readable in the same ligature shape); "श्यालं" ("wife's brother", a standard classical term, thematically fitting alongside "भ्रातृ-पत्न्यादिकान्", "brother's wife etc.", in a list of in-law relations) is adopted as the contextually and grammatically sound reading, since "इयाल" is not an attested Sanskrit word. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राज्यं चाकाशवृत्तिं च गानं च पितरं तथा । ऋणं चापि प्रवासं च व्योमस्थानान्निरीक्षयेत् ॥ ११ ॥

raajyan chaakaashavrittin cha gaanan cha pitaran tathaa | rinan chaapi pravaasan cha vyomasthaanaannireekshayet || 11 ||

अंग्रेज़ी अर्थ

One should examine (nireekshayet) from the house of the sky [the 10th] (vyoma-sthaanaat): kingdom (raajyam), and (cha) sky-conduct/public standing (aakaasha-vrittim), and (cha) singing (gaanam), and (tathaa) the father (pitaram), and also (cha api) debt (rinam), and (cha) travel abroad (pravaasam).

हिन्दी अर्थ

दशम भाव (आकाश-स्थान) से (व्योमस्थानान्) राज्य (राज्यं), और (च) आकाश-वृत्ति/लोक-व्यवहार (आकाशवृत्तिं), और (च) गायन (गानं), तथा (तथा) पिता (पितरं), और भी (चापि) ऋण (ऋणं), और (च) प्रवास (प्रवासं) को देखना चाहिए (निरीक्षयेत्)।

स्रोत: BPHS Ch.12, verse 11. PDF p.113, printed page ८१. Read from scratchpad/bphs-p113-v10-11.png, both lines clearly legible, matching the tentative overview reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नानावस्तुभवस्यापि पुत्रजायादिकस्य च । आयं सशुसमृद्धिं च भवस्थानान्निरीक्षयेत् ॥ १२ ॥

naanaavastubhavasyaapi putrajaayaadikasya cha | aayan sashusamriddhin cha bhavasthaanaannireekshayet || 12 ||

अंग्रेज़ी अर्थ

One should examine (nireekshayet) from the house of gain [the 11th] (bhava-sthaanaat): the origination/acquisition of manifold things (naanaa-vastu-bhavasya api), and (cha) that of sons, wife, etc. (putra-jaayaa-aadikasya), [and] income (aayam), and (cha) prosperity/abundance [of livestock] (sashu-samriddhim).

हिन्दी अर्थ

लाभ-भाव से (भवस्थानान्) नाना प्रकार की वस्तुओं की प्राप्ति (नानावस्तुभवस्यापि), और (च) पुत्र-पत्नी आदि की प्राप्ति (पुत्रजायादिकस्य), आय (आयं), और (च) [पशु-]समृद्धि (सशुसमृद्धिं) को देखना चाहिए (निरीक्षयेत्)।

स्रोत: BPHS Ch.12, verse 12. PDF p.113, printed page ८१. Line 1 confirmed via scratchpad/bphs-p113-v10-11.png; line 2 confirmed via scratchpad/bphs-p113-v12b-13.png and a dedicated word-level zoom scratchpad/bphs-p113-v12-word-zoom.png. AMBIGUITY DISCLOSED: the compound is clearly printed "सशुसमृद्धिं" with NO प akshara -- an initial suspicion (before zoom-confirmation) that this might be a compositor's contraction of "सपशुसमृद्धिं" ("with abundance of livestock", a more standard compound) could not be confirmed at full zoom; the printed reading "सशुसमृद्धिं" is preserved verbatim, though "स-अशु" or an elided "स(प)शु" cannot be fully ruled out as the source of a possible printing-era contraction. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

व्ययं च वैरिवृत्तान्तं रिष्टमन्त्यादिकं तथा । व्ययाच्चैव हि जानीयादिति सर्वत्र बुद्धिमान् ॥ १३ ॥

vyayan cha vairivrittaantan rishtamantyaadikan tathaa | vyayaachchaiva hi jaaneeyaaditi sarvatra buddhimaan || 13 ||

अंग्रेज़ी अर्थ

Expenditure (vyayam), and (cha) the course/account of enemies (vairi-vrittaantam), and (tathaa) affliction etc. at the very end [of life] (rishta-antya-aadikam) -- thus (iti) the wise one (buddhimaan) should know (jaaneeyaat) all of this (sarvatra), indeed (hi), from the 12th house of loss (vyayaat cha eva).

हिन्दी अर्थ

व्यय (व्ययं), और (च) शत्रुओं का वृत्तान्त (वैरिवृत्तान्तं), तथा (तथा) अन्त्य आदि अरिष्ट (रिष्टमन्त्यादिकं) -- इस प्रकार (इति) बुद्धिमान् (बुद्धिमान्) व्यक्ति को यह सब कुछ (सर्वत्र) व्यय-भाव से ही (व्ययाच्चैव हि) जानना चाहिए (जानीयात्)।

स्रोत: BPHS Ch.12, verse 13, closing this sub-section on houses 9 through 12. PDF p.113, printed page ८१. Read from scratchpad/bphs-p113-v12b-13.png, both lines fully legible, matching the tentative overview reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भावफलों का शुभाशुभत्व-- यो यो भावो ग्रहैः सौम्यैः स्वेशैर्युक्तोऽथवेक्षितः । युवा प्रबुद्धो राज्यस्थः, कुमारो यस्य वाधिपः ॥ १४ ॥

bhaavaphalon kaa shubhaashubhatva-- yo yo bhaavo grahaih saumyaih sveshairyukto'thavekshitah | yuvaa prabuddho raajyasthah, kumaaro yasya vaadhipah || 14 ||

अंग्रेज़ी अर्थ

[The auspicious/inauspicious nature of house-results:] Whichever (yah yah) house (bhaavah) is joined with (yuktah) or (athavaa) aspected by (eekshitah) benefic planets (grahaih saumyaih) or (cha) its own lord (sva-eshaih), and whose (yasya) lord (adhipah) is youthful (yuvaa), awakened (prabuddhah), [and] situated in exaltation/dignity (raajya-sthah) or (vaa) in its own sign as though a prince (kumaarah) --

हिन्दी अर्थ

[भाव-फलों की शुभाशुभता--] जो-जो (यो यो) भाव (भावो) शुभ ग्रहों से (ग्रहैः सौम्यैः) युक्त (युक्तः) अथवा (अथवा) अपने स्वामी से देखा गया (स्वेशैर्युक्तोऽथवेक्षितः) हो, और जिसका (यस्य) स्वामी (अधिपः) युवा (युवा), जागृत/प्रबुद्ध (प्रबुद्धः), उच्च/राज्य में स्थित (राज्यस्थः), अथवा कुमार के समान अपनी राशि में स्थित (कुमारो) हो --

स्रोत: BPHS Ch.12, verse 14, opening a new sub-section ("भावफलों का शुभाशुभत्व--", Hindi editorial sub-heading, prefixed here as a section label per the established convention -- read for corroboration and included since it demarcates a structurally distinct portion of the chapter). PDF p.114 (doc index 113, printed page ८२), header "बृहत्पाराशरहोराशास्त्रम्". Read from scratchpad/bphs-p114-v14-l1.png (line 1) and scratchpad/bphs-p114-v15-l1.png (line 2, which actually shows verse 14's second line at this y-offset), matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तद्दृष्टिवशतो ज्ञेयं तद्भावजफलं शुभम् । यद्यद्भावपतिर्नष्ट-त्रिकेशाद्यैश्च संयुतः ॥ १५ ॥

taddrishtivashato jneyan tadbhaavajaphalan shubham | yadyadbhaavapatirnashta-trikeshaadyaishcha sanyutah || 15 ||

अंग्रेज़ी अर्थ

By virtue of that [lord's] aspect (tad-drishti-vashatah), the auspicious (shubham) result arising from that house (tad-bhaava-ja-phalam) is to be known (jneyam). [But] whichever house's lord (yat yat bhaava-patih) is destroyed/afflicted (nashta) [or] joined with (samyutah) the lords of the trik houses [6th, 8th, 12th] etc. (trika-eesha-aadyaih cha) --

हिन्दी अर्थ

उसके (लग्नेश/भावेश के) दृष्टि के कारण (तद्दृष्टिवशतो) उस भाव से उत्पन्न शुभ फल (तद्भावजफलं शुभम्) जानना चाहिए (ज्ञेयं)। [किन्तु] जिस-जिस भाव का स्वामी (यद्यद्भावपतिः) नष्ट (नष्ट) [या] त्रिक भावों (६,८,१२) के स्वामियों आदि से (त्रिकेशाद्यैश्च) युक्त (संयुतः) हो --

स्रोत: BPHS Ch.12, verse 15. PDF p.114, printed page ८२. Read from scratchpad/bphs-p114-v16-l1.png (line 1, shown at this y-offset) and scratchpad/bphs-p114-v16-l2.png (line 2), matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भावं न वीक्षते सम्यग् ग्रहः सुप्तोऽथवा मृतः । स्थविरः पीडितो वापि, नष्टं भावफलं वदेत् ॥ १६ ॥ इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे भावविवेचनाध्यायः समाप्तः ॥ १२ ॥

bhaavan na veekshate samyag grahah supto'thavaa mritah | sthavirah peedito vaapi, nashtan bhaavaphalan vadet || 16 || iti savimarsha-sudhaavyaakhyopete brihatpaaraasharahoraashaastre bhaavavivechanaadhyaayah samaaptah || 12 ||

अंग्रेज़ी अर्थ

-- if the planet (grahah) does not (na) properly (samyak) aspect (veekshate) the house (bhaavam), or (athavaa) is dormant/combust (suptah) or (or) [in a] dead [degree] (mritah), [or is] aged (sthavirah), or also (vaa api) afflicted (peeditah), one should declare (vadet) the result of that house (bhaava-phalam) to be destroyed/nullified (nashtam). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion, the chapter on the discernment of the houses (bhaava-vivechana-adhyaayah) is concluded. Chapter 12.

हिन्दी अर्थ

-- यदि वह ग्रह (ग्रहः) भाव को (भावं) ठीक से (सम्यग्) न देखे (न वीक्षते), अथवा (अथवा) सुप्त/अस्तंगत (सुप्तः) या (अथवा) मृत [अंश में स्थित] (मृतः), वृद्ध (स्थविरः), अथवा भी (वापि) पीड़ित (पीडितः) हो, तो उस भाव का फल (भावफलं) नष्ट (नष्टं) कहना चाहिए (वदेत्)। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में भाव-विवेचन अध्याय (भावविवेचनाध्यायः) समाप्त होता है। अध्याय १२।

स्रोत: BPHS Ch.12, verse 16, closing the chapter, with the closing colophon appended per the established chapter-closing convention (cf. verses 10.45, 11.10). PDF p.114, printed page ८२. Verse 16 read from scratchpad/bphs-p114-v16-l2.png (line 1, shown as trailing content) and scratchpad/bphs-p114-v16-l2c.png (line 2, fully confirmed: "स्थविरः पीडितो वापि, नष्टं भावफलं वदेत् ॥ १६ ॥"). Colophon read from scratchpad/bphs-p114-colophon2.png ("भावविवेचनाध्यायः समाप्तः ॥ १२ ॥") and the fuller overview scratchpad/bphs-p114-overview.png (confirming the preceding "इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे" line). Following this colophon and an ornamental section-divider, the page contains an editorial passage citing a comparison verse from ANOTHER classical text ("जातक-पारिजात", Jataka Parijata) discussing the same auspicious/inauspicious house-result principle -- this quoted verse and its surrounding editorial discussion are excluded from transcription per copyright-safety discipline (modern editorial commentary quoting a different text, not BPHS root verses). Chapter 12 thus closes at exactly 16 verses.

संस्कृत

अथ प्रथम (तनु) भावफलाध्यायः ॥ १३ ॥ तनुपः केन्द्रकोणस्थोऽनिशं दद्यात्तनौ सुखम् । स एव त्रिकगः पापसंयुतस्तनुसौख्यहृत् ॥ १ ॥

atha prathama (tanu) bhaavaphalaadhyaayah || 13 || tanupah kendrakonastho'nishan dadyaattanau sukham | sa eva trikagah paapasanyutastanusaukhyahrit || 1 ||

अंग्रेज़ी अर्थ

[Chapter 13: The chapter on the results of the first (tanu, body) house.] The lord of the tanu [1st house] (tanu-pah), situated in a kendra or trikona (kendra-kona-sthah), constantly (anisham) gives (dadyaat) happiness (sukham) in the body (tanau). That very same [lord] (sah eva), if placed in a trik house [6th/8th/12th] (trika-gah) and joined with malefics (paapa-sanyutah), destroys bodily happiness (tanu-saukhya-hrit).

हिन्दी अर्थ

[अध्याय १३: तनु (प्रथम) भाव के फल का अध्याय।] तनु भाव का स्वामी (तनुपः), केन्द्र या त्रिकोण में स्थित (केन्द्रकोणस्थः), निरन्तर (अनिशं) शरीर में (तनौ) सुख (सुखं) देता है (दद्यात्)। वही (स एव) यदि त्रिक भाव (६,८,१२) में स्थित (त्रिकगः) होकर पाप ग्रहों से युक्त (पापसंयुतः) हो, तो वह शारीरिक सुख का नाश करने वाला (तनुसौख्यहृत्) होता है।

स्रोत: BPHS Chapter 13 opening: title "अथ प्रथम (तनु) भावफलाध्यायः ॥ १३ ॥" ("the chapter on the results of the first/tanu house") and verse 1, prefixed per the established chapter-opening convention. Unusually, no "पराशर उवाच--" invocation line appears here (unlike most preceding chapters) -- the verse begins directly after the title, confirmed by close reading of the page. Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.114 (doc index 113, printed page ८२), immediately following Chapter 12's colophon, an ornamental section-divider, and a brief editorial citation from another classical text (Jataka Parijata, excluded from transcription per copyright-safety discipline). Read from scratchpad/bphs-p114-ch13title4.png (title) and scratchpad/bphs-p114-ch13-v1-l1.png / scratchpad/bphs-p114-ch13-v1-l2.png (verse 1, both lines fully legible), matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तनुपोऽस्तमितो नीच-शत्रुभस्थोऽतिरोगकृत् । केन्द्र-त्रिकोणगाः सौम्याः सर्वरोगापहारकाः ॥ २ ॥

tanupo'stamito neecha-shatrubhastho'tirogakrit | kendra-trikonagaah saumyaah sarvarogaapahaarakaah || 2 ||

अंग्रेज़ी अर्थ

The lord of the tanu [1st house] (tanu-pah), set/combust (astamitah) and situated in the house of an enemy or debilitation (neecha-shatru-bha-sthah), causes great disease (ati-roga-krit). Benefic [planets] (saumyaah) situated in a kendra or trikona (kendra-trikona-gaah) remove all disease (sarva-roga-apahaarakaah).

हिन्दी अर्थ

तनु भाव का स्वामी (तनुपः), अस्तंगत (अस्तमितः) होकर शत्रु या नीच राशि में स्थित (नीच-शत्रुभस्थः), अत्यधिक रोग करने वाला (अतिरोगकृत्) होता है। केन्द्र या त्रिकोण में स्थित (केन्द्र-त्रिकोणगाः) शुभ ग्रह (सौम्याः) सम्पूर्ण रोगों को दूर करने वाले (सर्वरोगापहारकाः) होते हैं।

स्रोत: BPHS Ch.13, verse 2. PDF p.114, printed page ८२. Read from scratchpad/bphs-p114-ch13-v1-l2.png (line 1, shown as trailing content) and scratchpad/bphs-p114-ch13title3.png / scratchpad/bphs-p114-overview.png (line 2, corroborated), matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्ने शशिनि वा पापग्रहैर्युक्तेऽथवेक्षिते । सौम्यदृग्रहिते सौख्यं तनौ जातस्य नो भवेत् ॥ ३ ॥

lagne shashini vaa paapagrahairyukte'thavekshite | saumyadrigrahite saukhyan tanau jaatasya no bhavet || 3 ||

अंग्रेज़ी अर्थ

If the lagna (lagne) or (vaa) the Moon (shashini) is joined with (yukte) or (athavaa) aspected by (eekshite) malefic planets (paapa-grahaih), and is devoid of a benefic's aspect (saumya-drik-rahite), the native (jaatasya) will not (no) have (bhavet) bodily happiness (saukhyam) (tanau).

हिन्दी अर्थ

यदि लग्न (लग्ने) अथवा (वा) चन्द्रमा (शशिनि) पाप ग्रहों से युक्त (पापग्रहैर्युक्ते) अथवा (अथवा) देखा गया (ईक्षिते) हो, और शुभ ग्रह की दृष्टि से रहित (सौम्यदृग्रहिते) हो, तो जातक को (जातस्य) शरीर में (तनौ) सुख (सौख्यं) नहीं (नो) होता (भवेत्)।

स्रोत: BPHS Ch.13, verse 3. Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.115 (doc index 114, printed page ८३), header "प्रथम (तनु) भावफलाध्यायः". Read from scratchpad/bphs-p115-v3-4b.png (both lines fully legible), matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्ने शुभे तु सुभगस्तत्र पापे तु दुर्भगः । शुभग्रहैर्युते दृष्टे तनौ सौख्यं सुनिश्चितम् ॥ ४ ॥

lagne shubhe tu subhagastatra paape tu durbhagah | shubhagrahairyute drishte tanau saukhyan sunishchitam || 4 ||

अंग्रेज़ी अर्थ

If the lagna (lagne) [is occupied by] a benefic (shubhe), the native is fortunate (su-bhagah); but (tu) [if occupied] there (tatra) by a malefic (paape), he is (tu) unfortunate (dur-bhagah). If [the lagna is] joined with (yute) and aspected by (drishte) benefic planets (shubha-grahaih), happiness (saukhyam) in the body (tanau) is quite certain (su-nishchitam).

हिन्दी अर्थ

यदि लग्न (लग्ने) शुभ ग्रह से युक्त (शुभे) हो तो जातक सुभग (सुभगः) होता है, किन्तु (तु) वहाँ (तत्र) पाप ग्रह होने पर (पापे) वह दुर्भग (दुर्भगः) होता है (तु)। शुभ ग्रहों से युक्त (शुभग्रहैर्युते) और देखा गया (दृष्टे) होने पर शरीर में (तनौ) सुख (सौख्यं) निश्चित रूप से (सुनिश्चितम्) होता है।

स्रोत: BPHS Ch.13, verse 4. PDF p.115, printed page ८३. Read from scratchpad/bphs-p115-v3-4b.png (line 1, trailing) and scratchpad/bphs-p115-commentary34b.png (line 2, fully confirmed), matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

केन्द्र-त्रिकोणगोऽङ्घेशो बुधो जीवोऽथवा भृगुः । दीर्घायुर्मतिमान् जातो धनवान् राजवल्लभः ॥ ५ ॥

kendra-trikonago'nghesho budho jeevo'thavaa bhrigu | deerghaayurmatimaan jaato dhanavaan raajavallabhah || 5 ||

अंग्रेज़ी अर्थ

If the lord of the [1st] house (anghe-shah) -- or Mercury (budhah), Jupiter (jeevah), or (athavaa) Venus (bhriguh) -- is situated in a kendra or trikona (kendra-trikona-gah), the native (jaatah) is long-lived (deergha-aayuh), intelligent (mati-maan), wealthy (dhana-vaan), [and] a favourite of kings (raaja-vallabhah).

हिन्दी अर्थ

यदि [तनु] भाव का स्वामी (अङ्घेशः) -- अथवा बुध (बुधो), गुरु (जीवो), अथवा (अथवा) शुक्र (भृगुः) -- केन्द्र या त्रिकोण में स्थित (केन्द्र-त्रिकोणगः) हो, तो जातक (जातो) दीर्घायु (दीर्घायुः), बुद्धिमान् (मतिमान्), धनवान् (धनवान्), और राजा का प्रिय (राजवल्लभः) होता है।

स्रोत: BPHS Ch.13, verse 5. PDF p.115, printed page ८३. Line 1 read from scratchpad/bphs-p115-v5-l1b.png (fully confirmed after two mis-cropped attempts landed on the preceding verses-3-4 commentary block instead); line 2 confirmed from scratchpad/bphs-p115-v5-6.png and the overview, matching the tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नेशे चरराशिस्थे शुभग्रह-निरीक्षिते । कीर्ति-श्रीमान् महाभोगी देह-पुष्टि-समन्वितः ॥ ६ ॥

lagneshe chararaashisthe shubhagraha-nireekshite | keerti-shreemaan mahaabhogee deha-pushti-samanvitah || 6 ||

अंग्रेज़ी अर्थ

When the lagna-lord (lagna-eeshe) is situated in a movable sign (chara-raashi-sthe) and is observed by benefic planets (shubha-graha-nireekshite), [the native is] famous and prosperous (keerti-shreemaan), greatly enjoying (mahaa-bhogee), [and] endowed with bodily robustness (deha-pushti-samanvitah).

हिन्दी अर्थ

जब लग्नेश (लग्नेशे) चर राशि में स्थित (चरराशिस्थे) हो और शुभ ग्रहों से देखा गया (शुभग्रह-निरीक्षिते) हो, तो [जातक] कीर्तिवान् और श्रीमान् (कीर्ति-श्रीमान्), महाभोगी (महाभोगी), और शरीर की पुष्टि से युक्त (देह-पुष्टि-समन्वितः) होता है।

स्रोत: BPHS Ch.13, verse 6. PDF p.115, printed page ८३. Line 1 read from scratchpad/bphs-p115-v6b-7.png bottom row ("लग्नेशे चरराशिस्थे शुभग्रह-निरीक्षिते ।") and re-confirmed via scratchpad/bphs-p115-v6-l2.png's context; line 2 confirmed from scratchpad/bphs-p115-v6-l2.png ("कीर्ति-श्रीमान् महाभोगी देह-पुष्टि-समन्वितः ॥ ६ ॥"), matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जीवः शुक्रो बुधो वापि लग्ने शशि-समन्वितः । लग्नात् केन्द्रगतश्चापि राजलक्षण-संयुतः ॥ ७ ॥

jeevah shukro budho vaapi lagne shashi-samanvitah | lagnaat kendragatashchaapi raajalakshana-sanyutah || 7 ||

अंग्रेज़ी अर्थ

Jupiter (jeevah), Venus (shukrah), or (vaa) also (api) Mercury (budhah), in the lagna (lagne) joined with the Moon (shashi-samanvitah), or (cha api) situated in a kendra (kendra-gatah) reckoned from the lagna (lagnaat), is endowed with (sanyutah) royal characteristics (raaja-lakshana).

हिन्दी अर्थ

गुरु (जीवः), शुक्र (शुक्रो), अथवा (वापि) बुध (बुधो), लग्न में (लग्ने) चन्द्रमा से युक्त (शशि-समन्वितः), अथवा (चापि) लग्न से (लग्नात्) केन्द्र में स्थित (केन्द्रगतः), राजलक्षणों से युक्त (राजलक्षण-संयुतः) होता है।

स्रोत: BPHS Ch.13, verse 7. PDF p.115, printed page ८३. Line 1 read from scratchpad/bphs-p115-v7-l1.png ("जीवः शुक्रो बुधो वापि लग्ने शशि-समन्वितः ।"); line 2 read from scratchpad/bphs-p115-v7-l2b.png ("लग्नात् केन्द्रगतश्चापि राजलक्षण-संयुतः ॥ ७ ॥"), both matching the overview's tentative reading exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अजे वृषेऽथवा सिंहे लग्ने सारे ससूर्यजे । नालेन वेष्टितो जातो राज्यंशसदृशे तनौ ॥ ८ ॥

aje vrishe'thavaa sinhe lagne saare sasooryaje | naalena veshtito jaato raajyanshasadrishe tanau || 8 ||

अंग्रेज़ी अर्थ

If the lagna (lagne) is in Aries (aje), Taurus (vrishe), or (athavaa) Leo (sinhe), [and is] strong (saare) [and] joined with Saturn (sa-soorya-je, "[the planet] born of the Sun" -- i.e. Shani), the native (jaatah) is born (jaatah) wrapped by the umbilical cord (naalena veshtitah), with the body (tanau) resembling a royal portion/division (raajya-ansha-sadrishe).

हिन्दी अर्थ

यदि लग्न (लग्ने) मेष (अजे), वृष (वृषे), अथवा (अथवा) सिंह (सिंहे) राशि में हो, बलवान् (सारे) हो, और शनि (सूर्यज, अर्थात् सूर्य-पुत्र शनि) से युक्त (ससूर्यजे) हो, तो जातक (जातो) नाल से वेष्टित होकर (नालेन वेष्टितो) जन्म लेता है, तथा शरीर (तनौ) राज्यांश के समान (राज्यंशसदृशे) होता है।

स्रोत: BPHS Ch.13, verse 8. PDF p.115, printed page ८३. Line 1 zoom-confirmed via scratchpad/bphs-p115-v8-l1-zoom.png plus tight word-level zooms scratchpad/bphs-p115-v8-word1-zoom.png ("अजे वृषेऽथवा", confirming वृषे not वृपे) and scratchpad/bphs-p115-v8-word3-zoom2.png -- this last zoom corrects the overview's tentative "सशूर्यजे" to the printed "ससूर्यजे" ("स" + "सूर्यज", i.e. "joined with Saturn/Shani, [poetically] the Sun's son" -- सशूर्यजे is not a standard form, whereas ससूर्यजे parses correctly). Line 2 confirmed via scratchpad/bphs-p115-v8-l2.png and tight zoom scratchpad/bphs-p115-v8-word-zoom.png confirming "राज्यंशसदृशे" (not राश्यंशसदृशे -- the ज्य conjunct was verified at 8x zoom). The following Hindi commentary (scratchpad/bphs-p115-mid.png, scratchpad/bphs-p115-bottom-full.png, marked "॥ ८-९ ॥") explicitly corroborates this verse's content, describing nāla-veṣṭita (umbilical-cord-wrapped) birth when Saturn or Mars is in an Aries/Taurus/Leo lagna. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुष्पाद-गते सूर्ये द्विस्वभावगतैः परैः । घुचरैर्वलिभिर्जातो यमलत्वमवाप्नुयात् ॥ ९ ॥

chatushpaada-gate soorye dvisvabhaavagataih paraih | ghucharairvalibhirjaato yamalatvamavaapnuyaat || 9 ||

अंग्रेज़ी अर्थ

When the Sun (soorye) is situated in a quadruped [fixed-earthy] sign (chatushpaada-gate), and other [strong planets] (paraih) are situated in double-bodied signs (dvi-svabhaava-gataih) [along with an uncertain qualifier -- see source], the native born (jaatah) would attain (avaapnuyaat) twin-birth (yamalatvam).

हिन्दी अर्थ

जब सूर्य (सूर्ये) चतुष्पद राशि में स्थित (चतुष्पाद-गते) हो, और अन्य प्रबल ग्रह (परैः) द्विस्वभाव राशियों में स्थित (द्विस्वभावगतैः) हों [शेष पद अनिश्चित -- स्रोत देखें], तो जन्म लेने वाला जातक (जातो) यमल अर्थात् जुड़वाँ जन्म (यमलत्वम्) प्राप्त करता है (अवाप्नुयात्)।

स्रोत: BPHS Ch.13, verse 9. PDF p.115, printed page ८३. Line 1 ("चतुष्पाद-गते सूर्ये द्विस्वभावगतैः परैः ।") confirmed via scratchpad/bphs-p115-v8-l2.png and scratchpad/bphs-p115-mid.png, matching the overview's tentative reading exactly. Line 2's compound is genuinely ambiguous at this print's resolution even after a tight zoom (scratchpad/bphs-p115-v9-word-zoom.png at 12x): the printed text reads "घुचरैर्वलिभिर्जातो", differing from the initial tentative overview guess "धुचरैर्वैलिभिर्जातो" -- neither घुचर nor धुचर nor वलिभिः/वैलिभिः is a standard attested compound to me, so the exact intended reading of this qualifier remains uncertain and is disclosed here rather than forced; "यमलत्वमवाप्नुयात्" (twin-birth) itself is clearly legible and is corroborated by the following Hindi commentary (scratchpad/bphs-p115-bottom-full.png, marked "॥ ८-९ ॥"), which explicitly glosses this verse as "युग्म (युग्म) का जन्म होता है, अर्थात् दो बच्चे होते हैं" (a twin/paired birth occurs, i.e. two children) when the Sun is in a quadruped sign and another strong planet is in a double-bodied sign. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रविचन्द्रौ यदैकस्था-वेकांशकसमन्वितौ । त्रिमात्रा च त्रिभिर्मासैः पित्रा भ्रात्रा च पोषितः ॥ १० ॥

ravichandrau yadaikasthaa-vekaanshakasamanvitau | trimaatraa cha tribhirmaasaih pitraa bhraatraa cha poshitah || 10 ||

अंग्रेज़ी अर्थ

When (yadaa) the Sun and Moon (ravi-chandrau) are co-located in the same sign (eka-sthau) or (vaa) joined together in the same navamsha (eka-anshaka-samanvitau), [the native, born] threefold/as a triplet (tri-maatraa), is nurtured (poshitah) for three months (tribhih maasaih) by the father (pitraa) and (cha) by the brother (bhraatraa).

हिन्दी अर्थ

जब (यदा) सूर्य और चन्द्रमा (रविचन्द्रौ) एक ही राशि में स्थित (एकस्थौ) हों अथवा (वा) एक ही नवांश से युक्त (एकांशकसमन्वितौ) हों, तो [जातक] त्रिमात्र अर्थात् तीन [सन्तानों में से एक] (त्रिमात्रा) होकर तीन मासों तक (त्रिभिर्मासैः) पिता (पित्रा) और (च) भाई (भ्रात्रा) द्वारा पोषित (पोषितः) होता है।

स्रोत: BPHS Ch.13, verse 10. PDF p.115, printed page ८३, at the very bottom of the page. Line 1 confirmed via scratchpad/bphs-p115-v10-l1b.png; line 2 confirmed via scratchpad/bphs-p115-v10-l1.png and tight zoom scratchpad/bphs-p115-v10-word-zoom.png (confirming "भ्रात्रा", not an alternate reading), matching the overview's tentative reading exactly. This verse appears to complete a natural section/page boundary (chapter continues on the next PDF page for verse 11 onward). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एवमेव फलं वाच्यं चन्द्रादपि सदा बुधैः । अधुना जातकस्याङ्गे व्रणलक्ष्मादिकं शृणु ॥ ११ ॥

evameva phalan vaachyan chandraadapi sadaa budhaih | adhunaa jaatakasyaange vranalakshmaadikan shrinu || 11 ||

अंग्रेज़ी अर्थ

In this very same way (evam eva), the result (phalam) should always (sadaa) be declared (vaachyam) by the wise (budhaih) with respect to the Moon (chandraat) as well (api). Now (adhunaa) hear (shrinu) of the marks/blemishes, wounds, etc. (vrana-lakshma-aadikam) on the native's (jaatakasya) body (ange).

हिन्दी अर्थ

इसी प्रकार (एवमेव) चन्द्रमा से भी (चन्द्रादपि) सदा (सदा) विद्वानों द्वारा (बुधैः) फल (फलं) कहना चाहिए (वाच्यं)। अब (अधुना) जातक के अंग में (जातकस्याङ्गे) चिह्न, व्रण आदि (व्रणलक्ष्मादिकं) को सुनो (शृणु)।

स्रोत: BPHS Ch.13, verse 11. PDF p.116 (doc index 115, printed page ८४), header "बृहत्पाराशरहोराशास्त्रम्". Fully confirmed matching the page overview exactly, read from scratchpad/bphs-p116-v11-l2b.png and the overview scratchpad/bphs-p116-overview.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भावाः प्रोक्तास्तु तन्वाद्या आद्ये लग्न-द्रेष्काणके । शीर्षं च चक्षुषी कर्णौ नासे चापि कपोलके ॥ १२ ॥

bhaavaah proktaastu tanvaadyaa aadye lagna-dreshkaanake | sheershan cha chakshushee karnau naase chaapi kapolake || 12 ||

अंग्रेज़ी अर्थ

The houses (bhaavaah) beginning with tanu [the 1st house] (tanu-aadyaah) have indeed been described (proktaah tu) [as corresponding, in order, to the 12 decanates]. In the first (aadye) decanate of the lagna (lagna-dreshkaanake), [the body parts are] the head (sheersham), and (cha) the two eyes (chakshushee), the two ears (karnau), the nose (naase), and also (cha api) the cheek(s) (kapolake).

हिन्दी अर्थ

तनु आदि (तन्वाद्या) भाव (भावाः) [बारह द्रेष्काणों के क्रम से शरीर के अंगों के अनुरूप] कहे गए हैं (प्रोक्तास्तु)। लग्न के प्रथम द्रेष्काण में (आद्ये लग्न-द्रेष्काणके) सिर (शीर्षं), दोनों आँखें (चक्षुषी), दोनों कान (कर्णौ), नाक (नासे), और कपोल/गाल (कपोलके) होते हैं।

स्रोत: BPHS Ch.13, verse 12. PDF p.116, printed page ८४. Confirmed via multiple zoom rounds (scratchpad/bphs-p116-v12-word.png for "लग्न-द्रेष्काणके", scratchpad/bphs-p116-v12-l2d.png/-l2e.png for line 2), and cross-validated against verse 14's clearer instance of the term "द्रेष्काण" (drekkana/decanate). Matches the page overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

हनुर्मुखं च तनुतः क्रमाद् दक्षिणवामगाः । द्वितीये तु क्रमात् कण्ठः स्कन्धौ बाहू च पार्श्वके ॥ १३ ॥

hanurmukhan cha tanutah kramaad dakshinavaamagaah | dviteeye tu kramaat kanthah skandhau baahoo cha paarshvake || 13 ||

अंग्रेज़ी अर्थ

The chin and face (hanuh-mukham cha), [proceeding] from the body ('tanutah', i.e. continuing the enumeration) in order (kramaat), [are assigned] right and left (dakshina-vaama-gaah) [as the two halves of the first decanate's parts]. In the second [decanate] (dviteeye tu), in order (kramaat), [the parts are] the throat (kanthah), the two shoulders (skandhau), the two arms (baahoo), and (cha) the two sides/flanks (paarshvake).

हिन्दी अर्थ

ठुड्डी और मुख (हनुर्मुखं) क्रम से (क्रमाद्) दाहिने और बाएँ भाग (दक्षिणवामगाः) [प्रथम द्रेष्काण के अंगों में] होते हैं। द्वितीय द्रेष्काण में (द्वितीये तु) क्रम से (क्रमात्) कण्ठ (कण्ठः), दोनों कंधे (स्कन्धौ), दोनों भुजाएँ (बाहू), और दोनों पार्श्व/बगल (पार्श्वके) होते हैं।

स्रोत: BPHS Ch.13, verse 13. PDF p.116, printed page ८४. Line 1's "दक्षिणवामगाः" was initially misread as a variant "दाक्षणवामगाः" under an over-tight word-level zoom in an earlier pass, but a wider, cleaner re-crop (scratchpad/v13-wide-recheck.png) at moderate zoom clearly shows the standard reading "दक्षिणवामगाः" (द + क्षि, short i-matra) -- confirmed correct, no variant. Line 2 confirmed via scratchpad/bphs-p116-v13-l2b.png. Matches the page overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

हृदये च तथा कुक्षी नाभिश्चेत्युदितं बुधैः । एवं तृतीय-द्रेष्काणे वस्तिर्भेद्यं गुदं तथा ॥ १४ ॥

hridaye cha tathaa kukshee naabhishchetyuditan budhaih | evan triteeya-dreshkaane vastirbhedyan gudan tathaa || 14 ||

अंग्रेज़ी अर्थ

The heart (hridaye), and (cha) likewise (tathaa) the flank/belly (kukshee), and (cha) the navel (naabhih) -- thus (iti) it has been declared (uditam) by the wise (budhaih) [as the parts of the second decanate]. Similarly (evam), in the third decanate (triteeya-dreshkaane), the bladder (vastih), the genitals ('bhedyam', lit. that which is to be pierced/cut), and (cha) likewise (tathaa) the anus (gudam).

हिन्दी अर्थ

हृदय (हृदये), तथा (तथा) कोख/पेट (कुक्षी), और नाभि (नाभिः) -- इस प्रकार (चेति) विद्वानों द्वारा (बुधैः) कहा गया है (उदितं) [द्वितीय द्रेष्काण के अंग]। इसी प्रकार (एवं) तृतीय द्रेष्काण में (तृतीय-द्रेष्काणे) वस्ति/मूत्राशय (वस्तिः), गुह्यांग (भेद्यं), और गुदा (गुदं) तथा (तथा) होते हैं।

स्रोत: BPHS Ch.13, verse 14. PDF p.116, printed page ८४. Fully confirmed via scratchpad/bphs-p116-v14-l1c.png and -v14-l2c.png, matching the overview exactly; this verse's clear instance of "तृतीय-द्रेष्काणे" was used to cross-validate the same term's reading in verse 12. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वृषणद्वय सूरू च जानुनी चापि जङ्घके । चरणश्चेत्यवयवाः पुरतः पृष्ठतस्तनोः ॥ १५ ॥

vrishanadvaya sooroo cha jaanunee chaapi janghake | charanashchetyavayavaah puratah prishthatastanoh || 15 ||

अंग्रेज़ी अर्थ

The pair of testicles (vrishana-dvaya), and (cha) the thighs (sooroo), likewise (cha api) the two knees (jaanunee), and the two shanks (janghake), and (cha) the feet (charanah) -- thus (iti) [these are] the limbs (avayavaah), [reckoned] to the front and to the back (puratah prishthatah) of the body (tanoh).

हिन्दी अर्थ

वृषणों की जोड़ी (वृषणद्वय), जाँघें (सूरू/ऊरू), दोनों घुटने (जानुनी), और दोनों पिंडलियाँ (जङ्घके), तथा पैर (चरणः) -- इस प्रकार (चेति) ये अंग (अवयवाः) शरीर के आगे और पीछे (पुरतः पृष्ठतः) [गिने जाते हैं]।

स्रोत: BPHS Ch.13, verse 15. PDF p.116, printed page ८४. Line 2 fully confirmed via scratchpad/bphs-p116-v15-l2c.png. Line 1's second word, expected to be the standard "ऊरू" (thighs), was genuinely difficult to read at tight word-level zoom (appeared ambiguous, resembling "सक्रू") but a wider, cleaner re-crop at moderate zoom (scratchpad/v15-wide-recheck.png) clearly shows "सूरू" -- read here as a printed variant/misprint of the standard "ऊरू", retained as printed per zero-fabrication discipline (translated with its evident intended sense, thighs). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सपापेऽङ्गे व्रणं, क्रूरैः सवुधैर्नियतं च तत् । सशुभे शुभदृष्टे वा चिह्नमात्रं विनिर्दिशेत् ॥ १६ ॥ इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे प्रथम (तनु) भावाध्यायः समाप्तः ॥ १३ ॥

sapaape'nge vranan, krooraih savudhairniyatan cha tat | sashubhe shubhadrishte vaa chihnamaatran vinirdishet || 16 || iti savimarsha-sudhaavyaakhyopete brihatpaaraasharahoraashaastre prathama (tanu) bhaavaadhyaayah samaaptah || 13 ||

अंग्रेज़ी अर्थ

On the limb afflicted by a malefic (sa-paape ange), [there is] a wound (vranam); and that (cha tat) [wound] is certain (niyatam) [when the limb's significator/karaka planet is] joined with cruel [planets] (krooraih sa-...-aih, the exact joining-term being uncertain -- see note). [But] on the [limb] joined with a benefic (sa-shubhe) or aspected by a benefic (shubha-drishte vaa), one should declare (vinirdishet) merely a mark/birthmark (chihna-maatram). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion, the chapter on the results of the first (tanu) house is concluded. Chapter 13.

हिन्दी अर्थ

पाप ग्रह से युक्त अंग पर (सपापेऽङ्गे) व्रण/घाव (व्रणं) होता है, और वह (च तत्) क्रूर ग्रहों से युक्त होने पर (क्रूरैः [...]) निश्चित (नियतं) होता है (सटीक संयोजक शब्द अनिश्चित है -- टिप्पणी देखें)। [किन्तु] शुभ ग्रह से युक्त (सशुभे) या शुभ दृष्टि से देखे गए (शुभदृष्टे वा) अंग पर केवल चिह्न/जन्मचिह्न (चिह्नमात्रं) कहना चाहिए (विनिर्दिशेत्)। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में प्रथम (तनु) भावाध्याय (भावाध्यायः) समाप्त होता है (समाप्तः)। अध्याय १३।

स्रोत: BPHS Ch.13, verse 16, closing the chapter, with the closing colophon appended per the established chapter-closing convention (cf. verses 11.10, 12.16). PDF p.116, printed page ८४. Line 2 fully confirmed via scratchpad/v16-l2-bb.png/-cc.png, matching the overview exactly ("सशुभे शुभदृष्टे वा चिह्नमात्रं विनिर्दिशेत् ॥ १६ ॥"). Line 1 is fully legible except for one word between "क्रूरैः" and "नियतं": repeated zoom attempts at different magnifications (scratchpad/v16-l1-word.png, -word2.png, -wide-recheck.png) yield inconsistent readings -- a tight 20x zoom suggested a "यु" ligature (favoring "संयुतैः"/"सयुतैः", "joined together with"), while a wider, cleaner crop reads more like "सवुधैः" (an otherwise non-standard form). Transcribed here as printed at the wider, generally more reliable zoom level ("सवुधैः"), with this genuine ambiguity disclosed per the zero-fabrication/disclosure-without-forced-resolution convention (cf. 13.8, 13.9) rather than silently resolved; the verse's overall sense (malefic conjunction/affliction causing a wound; benefic conjunction/aspect causing a mere mark) is unaffected either way. Colophon ("इति सविमर्श-सुधाव्याख्योपेते ... प्रथम (तनु) भावाध्यायः समाप्तः ॥ १३ ॥") confirmed clearly in the full-page overview scratchpad/bphs-p116-overview.png. Chapter 13 closes at exactly 16 verses, matching Chapter 12's pattern. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ द्वितीय (धन) भावफलाध्यायः ॥ १४ ॥ पराशर उवाच :-- श्रुतं त्वया तु मैत्रेय ! तनुभावगतं फलम् । घनभावगतं वच्मि समाकर्ण्य शान्तधीः ॥ १ ॥

atha dviteeya (dhana) bhaavaphalaadhyaayah || 14 || paaraashara uvaacha :-- shrutan tvayaa tu maitreya ! tanubhaavagatan phalam | ghanabhaavagatan vachmi samaakarnya shaantadheeh || 1 ||

अंग्रेज़ी अर्थ

[Chapter 14: The chapter on the results of the second (dhana, wealth) house.] Parashara said:-- "O Maitreya, the result pertaining to the tanu-house [1st house] (tanu-bhaava-gatam phalam) has indeed been heard (shrutam) by you (tvayaa). O tranquil-minded one (shaanta-dheeh), listen attentively (samaakarnya) -- I shall now speak (vachmi) of that pertaining to the wealth-house (dhana-bhaava-gatam)."

हिन्दी अर्थ

[अध्याय १४: द्वितीय (धन) भाव के फल का अध्याय।] पराशर ने कहा:-- "हे मैत्रेय! तनु भाव से सम्बन्धित फल (तनुभावगतं फलम्) तुमने सुन लिया (श्रुतं त्वया)। हे शान्तबुद्धि (शान्तधीः), ध्यानपूर्वक सुनो (समाकर्ण्य) -- अब मैं धन भाव से सम्बन्धित फल (धनभावगतं) कहता हूँ (वच्मि)।"

स्रोत: BPHS Chapter 14 opening: title "अथ द्वितीय (धन) भावफलाध्यायः ॥ १४ ॥" ("the chapter on the results of the second/dhana house"), the "पराशर उवाच :--" invocation, and verse 1, all prefixed/confirmed per the established chapter-opening convention. Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.117 (doc index 116, printed page ८५), header "द्वितीय (धन) भावफलाध्यायः". Read from scratchpad/bphs-p117-title.png, -invoc.png, -v1.png, and scratchpad/bphs-p117-overview.png. Verse 1 line 2's opening word is printed "घनभावगतं" (with घ, gha) rather than the expected "धनभावगतं" (with ध, dha, matching the chapter's own title and every other occurrence of the word "धन" on this page, e.g. verse 9's clearly-ध "धनलाभाधिपे" in scratchpad/p117-dha-compare.png) -- a direct glyph comparison (scratchpad/p117-v1l2-word.png vs p117-dha-compare.png) confirms these are genuinely different letterforms in this printing, so "घनभावगतं" is retained here as an apparent printer's variant/typo of "धनभावगतं", per zero-fabrication discipline, translated with its evidently intended sense (the wealth-house). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनाधिपो धने केन्द्रे त्रिकोणे वा यदा स्थितः । धनधान्ययुतो जातो जायते नात्र संशयः ॥ २ ॥

dhanaadhipo dhane kendre trikone vaa yadaa sthitah | dhanadhaanyayuto jaato jaayate naatra sanshayah || 2 ||

अंग्रेज़ी अर्थ

When (yadaa) the lord of wealth (dhana-adhipah) is situated (sthitah) in the wealth [house] (dhane), in a kendra (kendre), or (vaa) in a trikona (trikone), the person born (jaatah) becomes (jaayate) endowed with wealth and grain (dhana-dhaanya-yutah) -- there is no doubt (na atra sanshayah) about this.

हिन्दी अर्थ

जब (यदा) धन का स्वामी (धनाधिपः) धन भाव में (धने), केन्द्र में (केन्द्रे), अथवा (वा) त्रिकोण में (त्रिकोणे) स्थित (स्थितः) हो, तो उत्पन्न जातक (जातो) धन-धान्य से युक्त (धनधान्ययुतो) होता है (जायते) -- इसमें कोई सन्देह नहीं (नात्र संशयः)।

स्रोत: BPHS Ch.14, verse 2. PDF p.117, printed page ८५. Confirmed via scratchpad/bphs-p117-v2.png and -v2b.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षष्ठेऽष्टमे व्यये वा चेद् धनक्षयकरस्तु सः । अर्थेऽर्थदः शुभे ज्ञेयः क्रूरस्तत्रार्थनाशकः ॥ ३ ॥

shashthe'shtame vyaye vaa ched dhanakshayakarastu sah | arthe'rthadah shubhe jneyah kroorastatraarthanaashakah || 3 ||

अंग्रेज़ी अर्थ

But if (ched) that [lord of wealth] (sah) [is instead placed] in the 6th, 8th, or (vaa) 12th house (shashthe ashtame vyaye), it becomes a destroyer of wealth (dhana-kshaya-karah tu). A benefic [planet] (shubhe) in the [2nd] wealth [house] (arthe) is to be known as (jneyah) a giver of wealth (artha-dah); a cruel [planet, malefic] (kroorah) there (tatra) is a destroyer of wealth (artha-naashakah).

हिन्दी अर्थ

परन्तु यदि (चेद्) वह [धनेश] (सः) षष्ठ, अष्टम, अथवा (वा) द्वादश भाव में (षष्ठेऽष्टमे व्यये) हो, तो वह धन का नाश करने वाला (धनक्षयकरस्तु) होता है। धन भाव में (अर्थे) शुभ ग्रह (शुभे) धन देने वाला (अर्थदः) जानना चाहिए (ज्ञेयः); वहाँ (तत्र) क्रूर ग्रह (क्रूरः) धन का नाश करने वाला (अर्थनाशकः) होता है।

स्रोत: BPHS Ch.14, verse 3. PDF p.117, printed page ८५. Confirmed via scratchpad/bphs-p117-v3.png and -v3b.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनाधिपो गुरुर्यस्य धनस्थानस्थितो यदि । भौमेन सहितो वापि धनवान् स नरो भवेत् ॥ ४ ॥

dhanaadhipo gururyasya dhanasthaanasthito yadi | bhaumena sahito vaapi dhanavaan sa naro bhavet || 4 ||

अंग्रेज़ी अर्थ

If (yadi) one's (yasya) lord of wealth (dhana-adhipah) is Jupiter (guruh), situated in the wealth house (dhana-sthaana-sthitah), or (vaa api) joined with Mars (bhaumena sahitah), that person (sah narah) becomes (bhavet) wealthy (dhanavaan).

हिन्दी अर्थ

यदि (यदि) जिसका (यस्य) धनेश (धनाधिपः) बृहस्पति (गुरुः) हो और धन स्थान में स्थित (धनस्थानस्थितो) हो, अथवा (वापि) मंगल के साथ (भौमेन सहितो) हो, तो वह मनुष्य (स नरो) धनवान् (धनवान्) होता है (भवेत्)।

स्रोत: BPHS Ch.14, verse 4. PDF p.117, printed page ८५. Confirmed via scratchpad/bphs-p117-v4.png and -v4b.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनेशे लाभराशिस्थे लाभेशे वा धनं गते । तावुभौ केन्द्रगौ कोणस्थितौ वा धनवान्नरः ॥ ५ ॥

dhaneshe laabharaashisthe laabheshe vaa dhanan gate | taavubhau kendragau konasthitau vaa dhanavaannarah || 5 ||

अंग्रेज़ी अर्थ

[If] the lord of wealth (dhana-eshe) is situated in the sign of gain [11th house] (laabha-raashi-sthe), or (vaa) the lord of gain (laabha-eshe) has gone to the wealth [house] (dhanam gate) -- [or if] those two (tau ubhau) are both situated in kendras (kendra-gau) or (vaa) situated in trikonas (kona-sthitau), the person (narah) is wealthy (dhanavaan).

हिन्दी अर्थ

[यदि] धनेश (धनेशे) लाभ राशि में स्थित (लाभराशिस्थे) हो, अथवा (वा) लाभेश (लाभेशे) धन भाव में गया हो (धनं गते) -- [अथवा] वे दोनों (तावुभौ) केन्द्र में स्थित (केन्द्रगौ) अथवा (वा) त्रिकोण में स्थित (कोणस्थितौ) हों, तो वह मनुष्य (नरः) धनवान् (धनवान्) होता है।

स्रोत: BPHS Ch.14, verse 5. PDF p.117, printed page ८५. Confirmed via scratchpad/bphs-p117-v5.png and -v5b.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनेशे केन्द्रराशिस्थे लाभेशे तत्त्रिकोणगे । गुरु-शुक्रयुते दृष्टे धनलाभमुदीरयेत् ॥ ६ ॥

dhaneshe kendraraashisthe laabheshe tattrikonage | guru-shukrayute drishte dhanalaabhamudeerayet || 6 ||

अंग्रेज़ी अर्थ

[If] the lord of wealth (dhana-eshe) is situated in a kendra sign (kendra-raashi-sthe), [and] the lord of gain (laabha-eshe) is in a trikona from that [kendra] (tat-trikona-ge), [and both/either are] joined with (yute) or (cha) aspected by (drishte) Jupiter and Venus (guru-shukra), one should predict (udeerayet) a gain of wealth (dhana-laabham).

हिन्दी अर्थ

[यदि] धनेश (धनेशे) केन्द्र राशि में स्थित (केन्द्रराशिस्थे) हो, [और] लाभेश (लाभेशे) उससे त्रिकोण में (तत्त्रिकोणगे) हो, [तथा दोनों/कोई भी] गुरु-शुक्र से युक्त (गुरु-शुक्रयुते) अथवा दृष्ट (दृष्टे) हों, तो धन-लाभ (धनलाभं) कहना चाहिए (उदीरयेत्)।

स्रोत: BPHS Ch.14, verse 6. PDF p.117, printed page ८५. Confirmed via scratchpad/bphs-p117-v6b.png (line 2) and the overview (line 1, "धनेशे केन्द्रराशिस्थे लाभेशे तत्त्रिकोणगे ।", partially visible in scratchpad/p117-v5b.png's trailing content), matching the overview exactly. Followed on the page by an extended Hindi prose commentary paraphrasing verses 1-6 (marked "॥१-६॥"), read for corroboration only and excluded from transcription per copyright-safety discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वित्तेशे रिपुभावस्थे लाभेशेऽपि च तद्गते । वित्तलाभौ युतौ पापैर्दृष्टौ वा निःस्व एव सः ॥ ७ ॥

vitteshe ripubhaavasthe laabheshe'pi cha tadgate | vittalaabhau yutau paapairdrishtau vaa nihsva eva sah || 7 ||

अंग्रेज़ी अर्थ

[If] the lord of wealth (vitta-eshe) is situated in the [6th,] enemy house (ripu-bhaava-sthe), and (cha) the lord of gain (laabha-eshe api) has also gone there (tat-gate) -- [or if] the [lords of] wealth and gain (vitta-laabhau), joined with (yutau) or (vaa) aspected by (drishtau) malefics (paapaih), [are so placed], that [person] (sah) is indeed (eva) destitute (nihsvah).

हिन्दी अर्थ

[यदि] धनेश (वित्तेशे) रिपु भाव (छठे भाव) में स्थित (रिपुभावस्थे) हो, और (च) लाभेश भी (लाभेशेऽपि) वहीं गया हो (तद्गते) -- [अथवा यदि] धन-लाभ के स्वामी (वित्तलाभौ) पाप ग्रहों से युक्त (युतौ पापैः) अथवा (वा) दृष्ट (दृष्टौ) हों, तो वह [जातक] (सः) निश्चय ही (एव) निर्धन (निःस्वः) होता है।

स्रोत: BPHS Ch.14, verse 7. PDF p.117, printed page ८५, following the Hindi commentary on verses 1-6. Confirmed via scratchpad/p117-bottom-wide.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वित्तायुषोः पती चास्तं गतौ पाप खगान्वितौ । जन्मप्रभृति दारिद्र्यं भिक्षान्नं लभते नरः ॥ ८ ॥

vittaayushoh patee chaastan gatau paapa khagaanvitau | janmaprabhriti daaridryan bhikshaannan labhate narah || 8 ||

अंग्रेज़ी अर्थ

[If] the two lords (patee) of wealth and longevity (vitta-aayushoh) have gone combust (astam gatau), and (cha) are joined with malefic planets (paapa-khaga-anvitau), the person (narah) obtains (labhate) poverty (daaridryam) and food by begging (bhiksha-annam) from birth onward (janma-prabhriti).

हिन्दी अर्थ

[यदि] धन और आयु के दोनों स्वामी (वित्तायुषोः पती) अस्तंगत हो जाएँ (चास्तं गतौ), और (च) पाप ग्रहों से युक्त (पाप खगान्वितौ) हों, तो वह मनुष्य (नरः) जन्म से लेकर (जन्मप्रभृति) दरिद्रता (दारिद्र्यं) और भिक्षा का अन्न (भिक्षान्नं) प्राप्त करता है (लभते)।

स्रोत: BPHS Ch.14, verse 8. PDF p.117, printed page ८५. Line 2 fully confirmed via scratchpad/p117-bottom-wide.png. Line 1's compound after "वित्ता" was genuinely difficult to resolve at the word level (scratchpad/p117-v8-word2.png, -word3.png): the printed glyphs read closer to "वित्तायययोः" than a clean "वित्तायुषोः", but "वित्तायुषोः" ("of the two [lords of] wealth-and-longevity", genitive dual of a वित्त+आयुस् compound) is the only standard Sanskrit form that fits both the grammar (dual, agreeing with "पती... गतौ...अन्वितौ") and the verse's sense (paralleling verse 7's wealth-and-gain-lord affliction with a wealth-and-longevity-lord affliction) -- transcribed as this standard resolved form per the disclosure-without-forced-resolution convention, with the genuine word-level ambiguity noted here rather than silently assumed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षष्ठाष्टमव्ययगते धनलाभाधिपे तथा । लाभे कुजे धने राहौ राजदण्डाद्धनक्षयः ॥ ९ ॥

shashthaashtamavyayagate dhanalaabhaadhipe tathaa | laabhe kuje dhane raahau raajadandaaddhanakshayah || 9 ||

अंग्रेज़ी अर्थ

When the lords of wealth and gain (dhana-laabha-adhipe) have likewise (tathaa) gone to the 6th, 8th, or 12th house (shashtha-ashtama-vyaya-gate), [and] Mars is in the gain [house] (laabhe kuje) [and] Rahu is in the wealth [house] (dhane raahau), wealth is destroyed through royal punishment (raaja-dandaat dhana-kshayah).

हिन्दी अर्थ

जब धन और लाभ के दोनों स्वामी (धनलाभाधिपे) भी (तथा) षष्ठ, अष्टम, अथवा द्वादश भाव में गए हों (षष्ठाष्टमव्ययगते), [और] लाभ भाव में मंगल (लाभे कुजे) [तथा] धन भाव में राहु (धने राहौ) हो, तो राजदण्ड के कारण (राजदण्डाद्) धन का नाश (धनक्षयः) होता है।

स्रोत: BPHS Ch.14, verse 9. PDF p.117, printed page ८५. Fully confirmed via scratchpad/p117-bottom-wide.png, matching the overview exactly. Contrary to an earlier tentative overview-only reading that assumed this verse might be cut off at the bottom of the page, a full re-crop of the page's lower section shows verses 7, 8, and 9 all completely visible on this page -- no content is missing or deferred to the next page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लाभे जीवे धने शुक्रे वित्तेशे शुभसंयुते । व्यये शुभग्रहयुते धर्ममूलो धनव्ययः ॥ १० ॥

laabhe jeeve dhane shukre vitteshe shubhasanyute | vyaye shubhagrahayute dharmamoolo dhanavyayah || 10 ||

अंग्रेज़ी अर्थ

[If] Jupiter (jeeve) is in the gain [house] (laabhe), Venus (shukre) is in the wealth [house] (dhane), [and] the lord of wealth (vitta-eshe) is joined with a benefic (shubha-sanyute), [and] the 12th house (vyaye) is joined with a benefic planet (shubha-graha-yute), the expenditure of wealth (dhana-vyayah) is rooted in dharma/righteousness (dharma-moolah).

हिन्दी अर्थ

[यदि] लाभ भाव में गुरु (लाभे जीवे), धन भाव में शुक्र (धने शुक्रे), और धनेश (वित्तेशे) शुभ ग्रह से युक्त (शुभसंयुते) हो, तथा द्वादश भाव (व्यये) शुभ ग्रह से युक्त (शुभग्रहयुते) हो, तो धन का व्यय (धनव्ययः) धर्म-मूलक (धर्ममूलो) होता है।

स्रोत: BPHS Ch.14, verse 10. PDF p.118 (doc index 117, printed page ८६), header "बृहत्पाराशरहोराशास्त्रम्", continuing directly from verse 9 (previous page ended with the Hindi commentary on verses 7-9, marked "॥ ७-९ ॥", excluded from transcription per copyright-safety discipline). Read from scratchpad/bphs-p118-overview.png (full-page render). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनेशे परमोच्चस्थे क्वा स्वभवनाश्रिते । गुरुणा वीक्षिते, जातः ख्यातः सर्वजनप्रियः ॥ ११ ॥

dhaneshe paramocchasthe kvaa svabhavanaashrite | guru naa veekshite, jaatah khyaatah sarvajanapriyah || 11 ||

अंग्रेज़ी अर्थ

[If] the lord of wealth (dhana-eshe) is situated in supreme exaltation (parama-uccha-sthe), or (kvaa) resorting to its own house (sva-bhavana-aashrite), [and] is aspected by Jupiter (guruna veekshite), the person born (jaatah) becomes renowned (khyaatah) [and] beloved by all people (sarva-jana-priyah).

हिन्दी अर्थ

[यदि] धनेश (धनेशे) परम उच्च में स्थित (परमोच्चस्थे) हो, अथवा (क्वा) अपने भवन में स्थित (स्वभवनाश्रिते) हो, [और] गुरु द्वारा देखा गया (गुरुणा वीक्षिते) हो, तो उत्पन्न जातक (जातः) प्रसिद्ध (ख्यातः) [और] सब लोगों को प्रिय (सर्वजनप्रियः) होता है।

स्रोत: BPHS Ch.14, verse 11. PDF p.118, printed page ८६. Line 1's second word is printed "क्वा" (confirmed via word-level zoom scratchpad/p118-v11-word2.png, showing a क्+व् conjunct with aa-matra, not the initially-suspected "क्रिवा") -- an uncommon but attested poetic/Prakrit-influenced form standing in for "वा" ("or"), retained as printed. Matches scratchpad/bphs-p118-overview.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनाधिपे शुभयुते स्थिते पारावतादिके । विविधा धनसम्पत्तिः स्वतस्तद्भवने भवेत् ॥ १२ ॥

dhanaadhipe shubhayute sthite paaraavataadike | vividhaa dhanasampattih svatastadbhavane bhavet || 12 ||

अंग्रेज़ी अर्थ

[If] the lord of wealth (dhana-adhipe), joined with a benefic (shubha-yute), is situated (sthite) in [an exalted sign, own sign, etc., illustratively termed] "paaraavata" and the like (paaraavata-aadike), various kinds (vividhaa) of wealth and property (dhana-sampattih) accrue spontaneously (svatah) in that person's own house (tat-bhavane).

हिन्दी अर्थ

[यदि] धनाधिप (धनाधिपे) शुभ ग्रह से युक्त (शुभयुते) होकर उच्च/स्वगृह आदि शुभ वर्ग में स्थित (स्थिते पारावतादिके) हो, तो उस [जातक] के अपने घर में स्वतः (स्वतस्तद्भवने) नाना प्रकार की धन-सम्पत्ति (विविधा धनसम्पत्तिः) होती है (भवेत्)।

स्रोत: BPHS Ch.14, verse 12. PDF p.118, printed page ८६. The printed page clearly shows the verse-ending numeral as "१६" (confirmed at high zoom, scratchpad/p118-v12numfinal2.png -- an unambiguous ६, not २), but this is evidently a typesetting error: the verse immediately follows verses numbered 10 and 11 in sequence, the very next verse on the page is numbered 13 (matching normal sequence), and the intervening Hindi commentary paragraph explicitly refers to this verse as part of the range "॥ १०-१२ ॥" (visible in scratchpad/bphs-p118-overview.png and scratchpad/p118-v1314b.png). The verse is therefore catalogued here as 14.12 (continuing the correct sequence 10-11-12-13-14), with the printed "१६" disclosed as an apparent printer's numbering slip rather than silently corrected in the transcription record. Sanskrit text itself fully confirmed via scratchpad/p118-v12line2.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नेत्रेशे बलसंयुक्ते शोभनाक्षो भवेन्नरः । षष्ठाऽष्टम-व्यय-गते नेत्रे वैकल्यमादिशेत् ॥ १३ ॥

netreshe balasanyukte shobhanaakshah bhavennarah | shashthaashtama-vyaya-gate netre vaikalyamaadishet || 13 ||

अंग्रेज़ी अर्थ

[If] the lord of the eyes [i.e. the 2nd lord] (netra-eshe) is endowed with strength (bala-sanyukte), the person (narah) has beautiful eyes (shobhana-akshah bhavet). [If it is] situated in the 6th, 8th, or 12th house (shashtha-ashtama-vyaya-gate), one should predict (aadishet) a defect/deformity (vaikalyam) in the eyes (netre).

हिन्दी अर्थ

[यदि] नेत्रेश (द्वितीयेश) (नेत्रेशे) बल से युक्त (बलसंयुक्ते) हो, तो मनुष्य (नरः) सुन्दर नेत्रों वाला (शोभनाक्षो) होता है (भवेत्)। [यदि वह] षष्ठ, अष्टम, या द्वादश भाव में गया हो (षष्ठाऽष्टम-व्यय-गते), तो नेत्र में (नेत्रे) विकलता/दोष (वैकल्यं) कहना चाहिए (आदिशेत्)।

स्रोत: BPHS Ch.14, verse 13. PDF p.118, printed page ८६. Confirmed via scratchpad/p118-v1314b.png, matching the overview exactly. This verse identifies the 2nd house's lord as also governing the eyes, distinct from its role as the wealth-lord. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनेशे पापसंयुक्ते धने पापसमन्विते । असत्यवादी पिशुनो भवेद् वातरुजार्दितः ॥ १४ ॥ इति सविमर्शं-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे धनभावफलाध्यायः समाप्तः ॥ १४ ॥

dhaneshe paapasanyukte dhane paapasamanvite | asatyavaadee pishuno bhaved vaatarujaarditah || 14 || iti savimarshan-sudhaavyaakhyopete brihatpaaraasharahoraashaastre dhanabhaavaphalaadhyaayah samaaptah || 14 ||

अंग्रेज़ी अर्थ

[If] the lord of wealth (dhana-eshe) is joined with malefics (paapa-sanyukte), [and] the wealth [house] (dhane) is likewise accompanied by malefics (paapa-samanvite), [the person] becomes (bhavet) a liar (asatya-vaadee), a slanderer (pishunah), [and] afflicted by wind-diseases (vaata-ruja-arditah). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion, the chapter on the results of the wealth house (dhana-bhaava-phala-adhyaayah) is concluded. Chapter 14.

हिन्दी अर्थ

[यदि] धनेश (धनेशे) पाप ग्रहों से युक्त (पापसंयुक्ते) हो, और धन भाव (धने) भी पाप ग्रहों से युक्त (पापसमन्विते) हो, तो [जातक] असत्यवादी (असत्यवादी), चुगलखोर (पिशुनो), और वातरोग से पीड़ित (वातरुजार्दितः) होता है (भवेद्)। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में धन-भाव-फल अध्याय (धनभावफलाध्यायः) समाप्त होता है। अध्याय १४।

स्रोत: BPHS Ch.14, verse 14. PDF p.118, printed page ८६. Confirmed via scratchpad/p118-v14b.png, matching the overview exactly. Followed on the page by Hindi commentary explaining verses 13-14, then a longer editorial discussion section headed "विमर्शः:--" (excluded from transcription per copyright-safety discipline). The chapter-closing colophon ("इति सविमर्शं-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे धनभावफलाध्यायः समाप्तः ॥ १४ ॥"), appended here per the established chapter-closing convention, was found on the FOLLOWING page (PDF p.119, doc index 118, printed page ८७) rather than this one -- confirmed via scratchpad/p119-colophon.png and scratchpad/bphs-p119-overview.png. Chapter 14 thus closes at exactly 14 verses. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ तृतीय (सहज) भावफलाध्यायः ॥ १५ ॥ पराशर उवाचः-- अथ मैत्रेय ! ते वच्मि फलं सहजभावजम् । सहजे सशुभे, दृष्टे सौम्यैर्वा भ्रातृमान् जनः ॥ १ ॥

atha triteeya (sahaja) bhaavaphalaadhyaayah || 15 || paaraashara uvaachah-- atha maitreya ! te vachmi phalan sahajabhaavajam | sahaje sashubhe, drishte saumyairvaa bhraatrimaan janah || 1 ||

अंग्रेज़ी अर्थ

[Chapter 15: The chapter on the results of the third (sahaja, sibling) house.] Parashara said:-- "Now (atha), O Maitreya, I shall tell (vachmi) you (te) the result (phalam) arising from the sahaja [3rd] house (sahaja-bhaava-jam). [If] the sahaja [house] (sahaje) is auspicious (sa-shubhe), [or] aspected by (drishte) or (vaa) joined with benefics (saumyaih), the person (janah) is endowed with brothers (bhraatrimaan).

हिन्दी अर्थ

[अध्याय १५: सहज (तृतीय) भाव के फल का अध्याय।] पराशर ने कहा:-- "अब (अथ), हे मैत्रेय, मैं तुम्हें (ते) सहज भाव से उत्पन्न फल (सहजभावजम्) कहता हूँ (वच्मि)। [यदि] सहज भाव (सहजे) शुभ (सशुभे) हो, [अथवा] शुभ ग्रहों से देखा गया (दृष्टे) या (वा) युक्त हो, तो मनुष्य (जनः) भाइयों से युक्त (भ्रातृमान्) होता है।

स्रोत: BPHS Chapter 15 opening: title, "पराशर उवाचः--" invocation, and verse 1, prefixed per the established chapter-opening convention. Kashi Sanskrit Series No.220 (ed. Devchandra Jha), PDF p.119 (doc index 118, printed page ८७), header "तृतीय (सहज) भावफलाध्यायः", following directly after Chapter 14's colophon (see the amended source note on verse 14.14) and an ornamental section-divider. The printed title reads "थअ तृतीय (सहज) भावफलाध्यायः" -- the first two syllables are printed in reversed order (थअ instead of अथ); every other chapter in this edition (cf. 13.1, 14.1) opens with the standard word order "अथ ... भावफलाध्यायः", so this is read here as a straightforward typesetting transposition and transcribed in the standard corrected order per the chapter-opening convention, with the printed anomaly disclosed rather than silently perpetuated. Read from scratchpad/bphs-p119-overview.png (full-page render) and word-level zooms scratchpad/p119-ch15title.png, p119-v1-word.png, p119-v1-word2.png (confirming "भ्रातृमान्", not an initially-suspected truncated "आतृमान्"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सभौमो भ्रातृभावेशो भ्रातृभावमभीक्षते । भ्रातृक्षेत्रगतो वापि सुखं भ्रातुर्विनिर्दिशेत् ॥ २ ॥

sabhaumo bhraatribhaavesho bhraatribhaavamabheekshate | bhraatrikshetragato vaapi sukhan bhraaturvinirdishet || 2 ||

अंग्रेज़ी अर्थ

[If] the lord of the brother-house (bhraatri-bhaava-eshah), together with Mars (sa-bhaumah, the karaka of brothers), looks well upon (abheekshate) the brother-house (bhraatri-bhaavam), or (vaa api) is situated in a brother's [i.e. Mars's] sign (bhraatri-kshetra-gatah), one should predict (vinirdishet) happiness (sukham) for the brother (bhraatuh).

हिन्दी अर्थ

[यदि] भ्रातृभाव का स्वामी (भ्रातृभावेशो) मंगल के साथ (सभौमो) भ्रातृभाव को (भ्रातृभावम्) भली-भाँति देखे (अभीक्षते), अथवा (वापि) भ्रातृ [मंगल] के क्षेत्र में स्थित (भ्रातृक्षेत्रगतो) हो, तो भाई का (भ्रातुः) सुख (सुखं) कहना चाहिए (विनिर्दिशेत्)।

स्रोत: BPHS Ch.15, verse 2. PDF p.119, printed page ८७. Confirmed via scratchpad/p119-v1-3.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तौ पापयोगतः पाप-क्षेत्रयोगेन वा पुनः । उत्पाद्य सहजान् सद्यो निहतो नात्र संशयः ॥ ३ ॥

tau paapayogatah paapa-kshetrayogena vaa punah | utpaadya sahajaan sadyo nihato naatra sanshayah || 3 ||

अंग्रेज़ी अर्थ

[If] those two (tau, the brother-lord and Mars), through conjunction with malefics (paapa-yogatah), or (vaa) again (punah) through conjunction via a malefic sign (paapa-kshetra-yogena), [are so afflicted, they act as] destroyers -- having produced (utpaadya) siblings (sahajaan), [they are] soon (sadyah) slain (nihatah) -- there is no doubt (na atra sanshayah) about this.

हिन्दी अर्थ

[यदि] वे दोनों (तौ, भ्रातृभावेश और मंगल) पाप ग्रहों के योग से (पापयोगतः), अथवा (वा) पुनः (पुनः) पाप-क्षेत्र के योग से (पापक्षेत्रयोगेन) [पीड़ित हों], तो सहजों (भाई-बहनों) को उत्पन्न करके (उत्पाद्य सहजान्) वे शीघ्र (सद्यो) नष्ट/मृत हो जाते हैं (निहतो) -- इसमें कोई सन्देह नहीं (नात्र संशयः)।

स्रोत: BPHS Ch.15, verse 3. PDF p.119, printed page ८७. Confirmed via scratchpad/p119-v1-3.png, matching the overview exactly. This verse, together with verse 2, is paraphrased in the following Hindi commentary block marked "॥ १-३ ॥" (excluded from transcription per copyright-safety discipline). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्त्रीग्रहो भ्रातृभावेशो भ्रातृगः स्त्रीग्रहोऽथवा । भगिनी स्यादथो भ्राता पुंग्रहे पुंग्रहो यदि ॥ ४ ॥

streegraho bhraatribhaavesho bhraatrigah streegraho'thavaa | bhaginee syaadatho bhraataa pungrahe pungraho yadi || 4 ||

अंग्रेज़ी अर्थ

[If] a feminine planet (stree-grahah) is the lord of the brother-house (bhraatri-bhaava-eshah), or (athavaa) a feminine planet is situated in the brother-house (bhraatri-gah stree-grahah), a sister (bhaginee) results (syaat). But then (athah), if (yadi) [it is] a masculine planet in a masculine planet's [house] (pum-grahe pum-grahah), a brother (bhraataa) [results].

हिन्दी अर्थ

[यदि] स्त्री ग्रह (स्त्रीग्रहो) भ्रातृभाव का स्वामी (भ्रातृभावेशो) हो, अथवा (अथवा) भ्रातृभाव में स्थित (भ्रातृगः) ग्रह स्त्री ग्रह (स्त्रीग्रहो) हो, तो बहन (भगिनी) होती है (स्यादथो)। किन्तु यदि (यदि) पुरुष ग्रह के [स्थान] में (पुंग्रहे) पुरुष ग्रह (पुंग्रहो) हो, तो भाई (भ्राता) [होता है]।

स्रोत: BPHS Ch.15, verse 4. PDF p.119, printed page ८७. Confirmed via scratchpad/p119-v4-7.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मिश्रे मिश्रफलं ज्ञेयं बलाबल-विवेकतः । सहजेशकुजौ रन्ध्रे पापैर्युक्तौ च वीक्षितौ ॥ ५ ॥

mishre mishraphalan jneyan balaabala-vivekatah | sahajeshakujau randhre paapairyuktau cha veekshitau || 5 ||

अंग्रेज़ी अर्थ

In a mixed case (mishre, i.e. of differing planetary genders), a mixed result (mishra-phalam) is to be known (jneyam) by discerning strength and weakness (bala-abala-vivekatah). The lord of the sahaja [house] (sahaja-eesha) and Mars (kujau), [if] situated in the 8th house (randhre), joined with (yuktau) and (cha) aspected by (veekshitau) malefics (paapaih), [become destroyers of the co-born, see verse 6].

हिन्दी अर्थ

मिश्र [ग्रहों के] होने पर (मिश्रे) मिश्र फल (मिश्रफलं) बल-अबल के विवेक से (बलाबल-विवेकतः) जानना चाहिए (ज्ञेयं)। सहज भाव का स्वामी (सहजेशकुजौ) और मंगल, अष्टम भाव में (रन्ध्रे) स्थित होकर पाप ग्रहों से युक्त (पापैर्युक्तौ) और (च) दृष्ट (वीक्षितौ) हों, [तो सहोदरों के नाशक होते हैं]।

स्रोत: BPHS Ch.15, verse 5. PDF p.119, printed page ८७. Confirmed via scratchpad/p119-v5-7.png, matching the overview exactly. The sense of this verse continues directly into verse 6's opening word "सोदरघ्नौ" (destroyers of the co-born). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सोदरघ्नौ, केन्द्रकोण-स्वोच्च-मित्र-स्ववर्गगे । भ्रातृपे कारके वापि, भ्रातृभावसुखं दिशेत् ॥ ६ ॥

sodaraghnau, kendrakona-svoccha-mitra-svavargage | bhraatripe kaarake vaapi, bhraatribhaavasukhan dishet || 6 ||

अंग्रेज़ी अर्थ

[The lord of the sahaja house and Mars, thus afflicted, are] destroyers of the co-born (sodara-ghnau). [But if instead] situated in a kendra, trikona, own exaltation, a friend's sign, or one's own varga (kendra-kona-sva-uccha-mitra-sva-varga-ge), [or if] the lord of brothers (bhraatri-pe) or the karaka [Mars] (kaarake) is also (vaa api) so placed, it bestows (dishet) happiness in the brother-house (bhraatri-bhaava-sukham).

हिन्दी अर्थ

[इस प्रकार पीड़ित सहजेश और मंगल] सहोदरों के नाशक (सोदरघ्नौ) होते हैं। [किन्तु यदि इसके विपरीत] केन्द्र, त्रिकोण, स्वोच्च, मित्र राशि, अथवा अपने वर्ग में स्थित (केन्द्रकोण-स्वोच्च-मित्र-स्ववर्गगे) हों, [या] भ्रातृपति (भ्रातृपे) अथवा कारक [मंगल] (कारके) भी (वापि) ऐसे स्थित हों, तो भ्रातृभाव का सुख (भ्रातृभावसुखं) देता है (दिशेत्)।

स्रोत: BPHS Ch.15, verse 6. PDF p.119, printed page ८७. Confirmed via scratchpad/p119-v5-7.png, matching the overview exactly. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भ्रातृपे कारके वापि सौम्यैर्युक्तेऽथवेक्षिते । भावे वा बलसंयुक्ते भ्रातृवृद्धिः प्रजायते ॥ ७ ॥

bhraatripe kaarake vaapi saumyairyukte'thaveekshite | bhaave vaa balasanyukte bhraatrivriddhih prajaayate || 7 ||

अंग्रेज़ी अर्थ

[If] the lord of brothers (bhraatri-pe) or (vaa api) the karaka [Mars] (kaarake) is joined with (yukte) or (athavaa) aspected by (eekshite) benefics (saumyaih), or (vaa) the [brother-]house (bhaave) is endowed with strength (bala-sanyukte), an increase of brothers (bhraatri-vriddhih) takes place (prajaayate).

हिन्दी अर्थ

[यदि] भ्रातृपति (भ्रातृपे) अथवा (वापि) कारक [मंगल] (कारके) शुभ ग्रहों से युक्त (सौम्यैर्युक्ते) अथवा (अथवा) दृष्ट (एक्षिते) हो, अथवा (वा) [भ्रातृ] भाव (भावे) बल से युक्त (बलसंयुक्ते) हो, तो भाइयों की वृद्धि (भ्रातृवृद्धिः) होती है (प्रजायते)।

स्रोत: BPHS Ch.15, verse 7. PDF p.119, printed page ८७, the last verse on this page. Confirmed via scratchpad/p119-bottom.png and scratchpad/p119-v5-7.png, matching the overview exactly. Chapter 15 continues onto the next page beyond verse 7. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भ्रातृभे बुधसंयुक्ते तदीशे चन्द्रसंयुते । कारके मन्दसंयुक्ते भगिन्येकाग्रतो भवेत् ॥ ८ ॥

bhraatribhe budhasanyukte tadeeshe chandrasanyute | kaarake mandasanyukte bhaginyekaagrato bhavet || 8 ||

अंग्रेज़ी अर्थ

[If] the sibling house (bhraatri-bhe) is joined with Mercury (budha-sanyukte), its lord (tad-eeshe) is joined with the Moon (chandra-sanyute), [and] the significator [of siblings, i.e. Mars] (kaarake) is joined with Saturn (manda-sanyukte), a sister (bhaginee) is born first (ekaagratah bhavet).

हिन्दी अर्थ

[यदि] भ्रातृभाव (भ्रातृभे) बुध से युक्त (बुधसंयुक्ते) हो, उसका स्वामी (तदीशे) चन्द्रमा से युक्त (चन्द्रसंयुते) हो, और कारक [मंगल] (कारके) शनि से युक्त (मन्दसंयुक्ते) हो, तो सबसे पहले बहन (भगिन्येकाग्रतो) उत्पन्न होती है (भवेत्)।

स्रोत: BPHS Ch.15, verse 8. PDF p.120 (doc index 119, printed page ८८), header "बृहत्पाराशरहोराशास्त्रम्", continuing directly from verse 7 (previous page ended with verse 7 as its last verse). Read from scratchpad/bphs-p120-overview.png, confirmed via scratchpad/p120-v8-11.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पश्चात् सहोदरोऽप्येक स्तृतीयस्तु मृतो भवेत् । कारके राहुसंयुक्ते विक्रमेशे तु नीचगे ॥ ९ ॥

pashchaat sahodaro'pyeka striteeyastu mrito bhavet | kaarake raahusanyukte vikrameshe tu neechage || 9 ||

अंग्रेज़ी अर्थ

Afterward (pashchaat), if the significator [of siblings] (kaarake) is joined with Rahu (raahu-sanyukte) [and] the 3rd lord (vikrama-eeshe) is debilitated (neechage), then one (eka) more sibling (sahodarah api) among those [born] afterward (pashchaat), the third one (triteeyah tu), is destined to die (mritah bhavet).

हिन्दी अर्थ

इसके पश्चात् (पश्चात्), यदि कारक (कारके) राहु से युक्त (राहुसंयुक्ते) हो और तृतीयेश (विक्रमेशे) नीच का हो (नीचगे), तो बाद में जन्मे सहोदरों में से एक (सहोदरोऽप्येक), तीसरा (तृतीयस्तु), मृत्यु को प्राप्त होता है (मृतो भवेत्)।

स्रोत: BPHS Ch.15, verse 9. PDF p.120, printed page ८८. "राहुसंयुक्ते" confirmed with the उ-मात्रा clearly visible via word-level zoom scratchpad/p120-v9-rahu2.png (ruling out a reading without the u-vowel). "स्तृतीयस्तु" printed as one compound word without an internal space (स + तृतीयस्तु, i.e. "sa tritiyastu") -- retained as printed. Confirmed via scratchpad/p120-v8-11.png and scratchpad/p120-v9-word.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पश्चात् सहोदराभावः-पूर्वं तु तत्त्रयं भवेत् । भ्रातृस्थानाधिपे केन्द्रे कारके तत्त्रिकोणगे ॥ १० ॥

pashchaat sahodaraabhaavah-poorvan tu tattrayan bhavet | bhraatristhaanaadhipe kendre kaarake tattrikonage || 10 ||

अंग्रेज़ी अर्थ

Thereafter (pashchaat) there is no loss/absence of siblings (sahodara-abhaavah) -- but this holds prior [to that outcome] (poorvam tu) [only if] these three conditions (tat-trayam) obtain (bhavet): the lord of the sibling house (bhraatri-sthaana-adhipe) [is] in a Kendra (kendre), [and] the significator (kaarake) [is] in a Trikona from it (tat-trikona-gate).

हिन्दी अर्थ

इसके पश्चात् (पश्चात्) सहोदरों का अभाव नहीं होता (सहोदराभावः), किन्तु यह पूर्व कथन (पूर्वं तु) तभी लागू होता है जब ये तीन बातें (तत्त्रयं) हों (भवेत्): भ्रातृस्थान का स्वामी (भ्रातृस्थानाधिपे) केन्द्र में (केन्द्रे), और कारक (कारके) उससे त्रिकोण में (तत्त्रिकोणगे) हो।

स्रोत: BPHS Ch.15, verse 10. PDF p.120, printed page ८८. Confirmed via scratchpad/p120-v12-13.png (overview crop) matching scratchpad/bphs-p120-overview.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जीवेन सहितेऽप्युच्चे वाच्या द्वादश सोदराः । तत्राग्रजद्वयं तद्वत् स्वस्माच्चापि तृतीयकः ॥ ११ ॥

jeevena sahite'pyucche vaachyaa dvaadasha sodaraah | tatraagrajadvayan tadvat svasmaachchaapi triteeyakah || 11 ||

अंग्रेज़ी अर्थ

[If] joined with Jupiter (jeevena sahite) or (api) exalted (ucche), twelve (dvaadasha) siblings (sodaraah) are to be declared (vaachyaa). Among these (tatra), two are elder (agraja-dvayam) in the same way (tadvat), and from oneself (svasmaat cha api) the third (triteeyakah) [is counted].

हिन्दी अर्थ

[यदि] गुरु से युक्त (जीवेन सहिते) अथवा (अपि) उच्च का (उच्चे) हो, तो बारह (द्वादश) सहोदर (सोदराः) कहने चाहिए (वाच्या)। उनमें से दो ज्येष्ठ (अग्रजद्वयं) उसी प्रकार (तद्वत्), और स्वयं से भी (स्वस्माच्चापि) तीसरा (तृतीयकः) [गिना जाता है]।

स्रोत: BPHS Ch.15, verse 11. PDF p.120, printed page ८८. Confirmed via scratchpad/p120-v12-13.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सप्तमो नवमश्चैव द्वादशश्च मृतो भवेत् । ज्ञेयाः सहोदराः शेषाः षट् स्युदीर्घायुषान्विताः ॥ १२ ॥

saptamo navamashchaiva dvaadashashcha mrito bhavet | gyeyaah sahodaraah sheshaah shat syurdeerghaayushaanvitaah || 12 ||

अंग्रेज़ी अर्थ

The seventh (saptamah), the ninth (navamah), and (cha eva) the twelfth (dvaadashah cha) are destined to die (mritah bhavet). The remaining (sheshaah) six (shat) siblings (sahodaraah) are to be known (gyeyaah) as endowed with long life (deergha-aayusha-anvitaah).

हिन्दी अर्थ

सातवाँ (सप्तमो), नवाँ (नवमश्चैव), और बारहवाँ (द्वादशश्च) मृत्यु को प्राप्त होता है (मृतो भवेत्)। शेष (शेषाः) छह (षट्) सहोदर (सहोदराः) दीर्घायु से युक्त (दीर्घायुषान्विताः) जानने चाहिए (ज्ञेयाः स्युः)।

स्रोत: BPHS Ch.15, verse 12. PDF p.120, printed page ८८. "सप्तमो" printed with a tightly-set प्-त conjunct that at first glance resembles स्त -- confirmed as सप्तमो via word-level zoom scratchpad/p120-v12-word.png. Confirmed via scratchpad/p120-v12-13.png. This verse and the two preceding it are explained together by the Hindi commentary's own citation "॥ १०-१२ ॥" seen in scratchpad/bphs-p118-overview.png (Ch.14 page) is unrelated; the applicable commentary for this verse trio appears further down this same page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लाभेशेन युते भौमे गुरुणा सहितेऽपि वा । सहजस्थानगे चन्द्रे सप्तसंख्याः सहोदराः ॥ १३ ॥

laabheshena yute bhaume guruna sahite'pi vaa | sahajasthaanage chandre saptasankhyaah sahodaraah || 13 ||

अंग्रेज़ी अर्थ

[If] Mars (bhaume) is joined with the lord of gain (laabha-eshena yute), or (vaa) also (api) joined with Jupiter (guruna sahite), [and] the Moon (chandre) is situated in the sibling house (sahaja-sthaana-gate), the siblings (sahodaraah) number seven (sapta-sankhyaah).

हिन्दी अर्थ

[यदि] मंगल (भौमे) लाभेश से युक्त (लाभेशेन युते) हो, अथवा (वा) गुरु से भी युक्त (गुरुणा सहितेऽपि) हो, और चन्द्रमा (चन्द्रे) सहज भाव में स्थित (सहजस्थानगे) हो, तो सहोदर (सहोदराः) संख्या में सात (सप्तसंख्याः) होते हैं।

स्रोत: BPHS Ch.15, verse 13. PDF p.120, printed page ८८. "सप्तसंख्याः" printed with the same tightly-set प्-त conjunct as verse 12's सप्तमो -- confirmed via word-level zoom scratchpad/p120-v13-word2.png. Confirmed via scratchpad/p120-v13-15.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सहजस्थानगे चन्द्रे पुंग्रहेणैव वीक्षिते । भ्रातरस्तत्र कविना भगिन्यः संयुतेक्षिते ॥ १४ ॥

sahajasthaanage chandre pungraheneva veekshite | bhraatarastatra kavinaa bhaginyah sanyutekshite || 14 ||

अंग्रेज़ी अर्थ

[If] the Moon (chandre) situated in the sibling house (sahaja-sthaana-gate) is aspected only by a male planet (pun-grahena eva veekshite), there are brothers there (bhraatarah tatra); [if] aspected while joined with a female planet (kavinaa sanyuta-eekshite), [there are] sisters (bhaginyah).

हिन्दी अर्थ

[यदि] सहज भाव में स्थित (सहजस्थानगे) चन्द्रमा (चन्द्रे) केवल पुंग्रह द्वारा देखा गया (पुंग्रहेणैव वीक्षिते) हो, तो वहाँ भाई होते हैं (भ्रातरस्तत्र); [यदि] स्त्रीग्रह से युक्त होकर देखा गया (कविना संयुतेक्षिते) हो, तो बहनें (भगिन्यः) होती हैं।

स्रोत: BPHS Ch.15, verse 14. PDF p.120, printed page ८८. Second line's first word confirmed as "भ्रातरस्तत्र" (not an apparent "आतरस्तत्र" suggested by a lower-resolution read) via word-level zoom scratchpad/p120-v14b.png, which clearly shows the भ्रा conjunct at the line's start. "कविना" (literally "by the poet") is retained as printed; in context it stands as a poetic/technical term for a female-signifying planet, parallel to "पुंग्रहेण" for a male-signifying one. Confirmed via scratchpad/p120-v13-15.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अग्रजं दिनकृद्धन्ति मन्दः पृष्ठगतं तथा । उभयं भूमिजो हन्ति सहजस्थो विनिश्चयात् ॥ १५ ॥ इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे सहजभावफलाध्यायः समाप्तः ॥ १५ ॥

agrajan dinakriddhanti mandah prishthagatan tathaa | ubhayan bhoomijo hanti sahajastho vinishchayaat || 15 || iti savimarsha-sudhaavyaakhyopete brihatpaaraasharahoraashaastre sahajabhaavaphalaadhyaayah samaaptah || 15 ||

अंग्रेज़ी अर्थ

The Sun (dinakrit) kills (hanti) the elder [sibling] (agrajam); Saturn (mandah), likewise (tathaa), [kills] the younger [i.e. the one born after] (prishtha-gatam). Mars (bhoomijah), when situated in the sibling house (sahaja-sthah), kills (hanti) both (ubhayam) -- so it should be determined (vinishchayaat). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion, the chapter on the results of the sibling house (sahaja-bhaava-phala-adhyaayah) is concluded. Chapter 15.

हिन्दी अर्थ

सूर्य (दिनकृत्) ज्येष्ठ [भाई-बहन] (अग्रजं) को मारता है (हन्ति); शनि (मन्दः) उसी प्रकार (तथा) कनिष्ठ [बाद में जन्मे] (पृष्ठगतं) को [मारता है]। मंगल (भूमिजो), सहज भाव में स्थित होकर (सहजस्थो), दोनों को (उभयं) मारता है (हन्ति) -- ऐसा निश्चय करना चाहिए (विनिश्चयात्)। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में सहज-भाव-फल अध्याय (सहजभावफलाध्यायः) समाप्त होता है। अध्याय १५।

स्रोत: BPHS Ch.15, verse 15. PDF p.120, printed page ८८. Last verse on this page -- followed immediately by Hindi commentary beginning "मंगल आयेष्टयुक्त हो या गुरु-समन्वित हो..." which continues onto the next page; Chapter 15 therefore continues beyond this verse. Confirmed via scratchpad/p120-v13-15.png and scratchpad/bphs-p120-overview.png. English/Hindi meanings by Vedic Hora -- for review. The chapter-closing colophon ("इति सविमर्श-सुधाव्याख्योपेते वृहत्पाराशरहोराशास्त्रे सहजभाव-फलाध्यायः समाप्तः ॥ १५ ॥", appended here per the established chapter-closing convention) was confirmed on PDF p.121 (doc index 120, printed page ८९), immediately preceding the opening of Chapter 16 -- see scratchpad/p121-colophon2.png and scratchpad/p121-colophon3.png. The printed colophon renders the text's title as "वृहत्पाराशरहोराशास्त्रे" (व rather than the expected ब), consistent with this edition's recurring व/ब typeface ambiguity (cf. this chapter's own "वन्धु"/"बन्धु" instances); standard "बृहत्पाराशरहोराशास्त्रे" transcribed per the established colophon convention. Chapter 15 thus closes at exactly 15 verses.

संस्कृत

अथ चतुर्थ (सुख) भावफलाध्यायः ॥ १६ ॥ पराशर उवाचः-- मैत्रेय ! ते निगदितं भ्रातृभावगतं फलम् । अघुना कथ्यते मातृभावजं तन्मुने श्रृणु ॥ १ ॥

atha chaturtha (sukha) bhaavaphalaadhyaayah || 16 || paraashara uvaachah-- maitreya ! te nigaditan bhraatribhaavagatan phalam | aghunaa kathyate maatribhaavajan tanmune shrinu || 1 ||

अंग्रेज़ी अर्थ

Now [begins] the fourth (sukha/happiness) house-results chapter. Chapter 16. Parashar said: O Maitreya, the fruit (phalam) pertaining to the sibling house (bhraatri-bhaava-gatam) has been declared (nigaditam) to you (te). Now (adhunaa) the fruit born of the mother-house (maatri-bhaava-jam) is told (kathyate); listen (shrinu) to that, O sage (tat-mune).

हिन्दी अर्थ

अब चतुर्थ (सुख) भाव के फल का अध्याय आरम्भ होता है। अध्याय १६। पराशर ने कहा: हे मैत्रेय! तुम्हें भ्रातृभाव सम्बन्धी फल (भ्रातृभावगतं फलम्) कह दिया गया (निगदितं)। अब (अधुना) मातृभाव से उत्पन्न फल (मातृभावजं) कहा जाता है (कथ्यते); हे मुने, उसे सुनो (श्रृणु)।

स्रोत: BPHS Ch.16, verse 1. PDF p.121 (doc index 120, printed page ८९), header "चतुर्थ (सुख) भावफलाध्यायः". Chapter title, colophon-style heading and "पराशर उवाचः--" invocation prefixed to this verse per the established chapter-opening convention. Second line's second word is printed "अघुना" (अ+घ, not अ+ध) -- an apparent घ/ध variant of the standard "अधुना" ("now"), retained as printed per the disclosure-without-forced-resolution convention (cf. Ch.14 v1's analogous घ/ध case); confirmed via word-level zoom scratchpad/p121-v1-word.png. Read from scratchpad/bphs-p121-overview.png, confirmed via scratchpad/p121-v1-3b.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वन्धुभावगते वन्धुनाथे वा तत्र लग्नपे । सौम्यखेटेक्षितयुते पूर्णगेहसुखं भवेत् ॥ २ ॥

bandhubhaavagate bandhunaathe vaa tatra lagnape | saumyakhetekshitayute poornagehasukhan bhavet || 2 ||

अंग्रेज़ी अर्थ

[If a benefic planet] situated in the kin house (bandhu-bhaava-gate), or the lord of kin (bandhu-naathe), or (vaa) the lord of the ascendant (lagna-pe) there (tatra), is joined with or aspected by a benefic planet (saumya-kheta-eekshita-yute), full (poorna) household happiness (geha-sukham) results (bhavet).

हिन्दी अर्थ

[यदि कोई शुभ ग्रह] बन्धुभाव में स्थित (वन्धुभावगते) हो, अथवा बन्धुनाथ (वन्धुनाथे), अथवा (वा) वहाँ का लग्नेश (तत्र लग्नपे), शुभ ग्रह से युक्त या दृष्ट हो (सौम्यखेटेक्षितयुते), तो पूर्ण (पूर्ण) गृह-सुख (गेहसुखं) होता है (भवेत्)।

स्रोत: BPHS Ch.16, verse 2. PDF p.121, printed page ८९. Both instances of the word for "kin" are printed with व (वन्धु) rather than the standard ब (बन्धु) -- confirmed via word-level zoom scratchpad/p121-v2-word.png, showing a consistent व in both "वन्धुभावगते" and "वन्धुनाथे". Retained as printed; likely reflects this edition's typeface rendering ब and व similarly (recurring pattern, also seen in verse 5's "वन्धुपूज्यो"). Confirmed via scratchpad/p121-v1-3b.png and scratchpad/p121-v3.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वक्षांशतुङ्गे तुर्यनाथे सुखमनुत्तमम् । गृहभूयानमात्रादिजातं वाद्यादिजं तथा ॥ ३ ॥

svakshaanshatunge turyanaathe sukhamanuttamam | grihabhooyaanamaatraadijaatan vaadyaadijan tathaa || 3 ||

अंग्रेज़ी अर्थ

[If] the 4th lord (turya-naathe) is in own-navamsha exaltation (sva-kshaansha-tunge), supreme happiness (sukham anuttamam) [results], along with (tathaa) that born of house, vehicle, mother, and the like (griha-bhooyaana-maatraa-aadi-jaatam), and of music/instruments and the like (vaadya-aadi-jam).

हिन्दी अर्थ

[यदि] चतुर्थेश (तुर्यनाथे) अपने अंश में उच्च का (स्वक्षांशतुङ्गे) हो, तो उत्तम सुख (सुखमनुत्तमम्) होता है, साथ ही (तथा) घर, वाहन, माता आदि से उत्पन्न सुख (गृहभूयानमात्रादिजातं), और वाद्य आदि से उत्पन्न सुख (वाद्यादिजं) भी होता है।

स्रोत: BPHS Ch.16, verse 3. PDF p.121, printed page ८९. First word confirmed via word-level zoom scratchpad/p121-v3-word.png as "स्वक्षांशतुङ्गे" (svakshaansha = "own [navamsha-]division", tunge = "exalted"). Confirmed via scratchpad/p121-v3.png and scratchpad/p121-v4.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तुर्यकर्मेशयोः केन्द्रे त्रिकोणे वा सहस्थितौ । राजाह्वे सदने वासो जातकस्य भवेद्ध्रुवम् ॥ ४ ॥

turyakarmeshayoh kendre trikone vaa sahasthitau | raajaahve sadane vaaso jaatakasya bhaveddhruvam || 4 ||

अंग्रेज़ी अर्थ

[If] the lords of the 4th and 10th [houses] (turya-karma-eeshayoh) are together situated (saha-sthitau) in a Kendra (kendre) or (vaa) a Trikona (trikone), residence (vaasah) in a house called "royal"/palatial (raajaa-ahve sadane) is certain (dhruvam) for the person born (jaatakasya bhavet).

हिन्दी अर्थ

[यदि] चतुर्थ और दशम भाव के स्वामी (तुर्यकर्मेशयोः) केन्द्र (केन्द्रे) या (वा) त्रिकोण (त्रिकोणे) में एक साथ स्थित हों (सहस्थितौ), तो जातक का (जातकस्य) राजभवन-तुल्य घर में (राजाह्वे सदने) निवास (वासो) निश्चित (ध्रुवम्) होता है (भवेत्)।

स्रोत: BPHS Ch.16, verse 4. PDF p.121, printed page ८९. "राजाह्वे" confirmed via word-level zoom scratchpad/p121-v4-word.png. Confirmed via scratchpad/p121-v4.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तुर्यनाथे सौम्यखेटे शुभैर्युक्तेऽथवेक्षिते । लग्नगे शशिजे जातो वन्धुपूज्यो भवेत्सदा ॥ ५ ॥

turyanaathe saumyakhete shubhairyukte'thavekshite | lagnage shashije jaato bandhupoojyo bhavetsadaa || 5 ||

अंग्रेज़ी अर्थ

[If] the 4th lord (turya-naathe), being a benefic planet (saumya-khete), is joined with benefics or (athavaa) aspected [by them] (shubhaih yukte ekshite), and the Moon (shashije) is in the ascendant (lagna-gate), the person born (jaatah) is ever (sadaa) worthy of kinsmen's honor (bandhu-poojyah bhavet).

हिन्दी अर्थ

[यदि] चतुर्थेश (तुर्यनाथे), शुभ ग्रह होकर (सौम्यखेटे), शुभ ग्रहों से युक्त अथवा (अथवा) दृष्ट हो (शुभैर्युक्तेऽथवेक्षिते), और चन्द्रमा (शशिजे) लग्न में हो (लग्नगे), तो उत्पन्न जातक (जातो) सदा (सदा) बन्धुओं द्वारा पूज्य (वन्धुपूज्यो) होता है (भवेत्)।

स्रोत: BPHS Ch.16, verse 5. PDF p.121, printed page ८९. "वन्धुपूज्यो" printed with व (as in verse 2's "वन्धु" instances) rather than the standard ब of "बन्धु" -- retained as printed per the same recurring व/ब disclosure. "शशिजे" here refers to the Moon (chandra), used loosely rather than in its more common sense of Mercury ("son of the Moon"); retained as printed. Confirmed via scratchpad/p121-v5.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मातुः स्थाने शुभयुते तदीशे स्वोच्चराशिगे । कारके बलसंयुक्ते मातृदीर्घायुरादिशेत् ॥ ६ ॥

maatuh sthaane shubhayute tadeeshe svochcharaashige | kaarake balasanyukte maatrideerghaayuraadishet || 6 ||

अंग्रेज़ी अर्थ

[If] the mother's house (maatuh sthaane) is joined with a benefic (shubha-yute), its lord (tad-eeshe) is in its own or exaltation sign (sva-uchcha-raashi-gate), [and] the significator [i.e. the Moon] (kaarake) is endowed with strength (bala-sanyukte), one should predict (aadishet) the mother's long life (maatri-deergha-aayuh).

हिन्दी अर्थ

[यदि] मातृस्थान (मातुः स्थाने) शुभ ग्रह से युक्त (शुभयुते) हो, उसका स्वामी (तदीशे) अपनी उच्च राशि में स्थित (स्वोच्चराशिगे) हो, और कारक [चन्द्रमा] (कारके) बल से युक्त (बलसंयुक्ते) हो, तो माता की दीर्घायु (मातृदीर्घायु) कहनी चाहिए (आदिशेत्)।

स्रोत: BPHS Ch.16, verse 6. PDF p.121, printed page ८९. Second line's compound "मातृदीर्घायुरादिशेत्" (word-level zoom scratchpad/p121-v6-word.png) parses as मातृदीर्घायुः + आदिशेत् via standard visarga sandhi (-uh + aa- -> -u raa-); printed with an internal space as "मातृदीर्घायु रादिशेत्" in the source, rejoined here as the single sandhied compound per normal Sanskrit orthography. Confirmed via scratchpad/p121-v6.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुखेशे केन्द्रभावस्थे तथा केन्द्रे स्थिते भृगौ । शशिजे चोच्चराशिस्थे यानसौख्यं वदेद् बुधः ॥ ७ ॥

sukheshe kendrabhaavasthe tathaa kendre sthite bhrigau | shashije chochcharaashisthe yaanasaukhyan vaded budhah || 7 ||

अंग्रेज़ी अर्थ

[If] the lord of happiness [the 4th lord] (sukha-eshe) is situated in a Kendra house (kendra-bhaava-sthe), and likewise (tathaa) Venus (bhrigau) is situated in a Kendra (kendre sthite), and the Moon (shashije) is in an exaltation sign (uchcha-raashi-sthe), Mercury (budhah) should declare (vadet) happiness pertaining to conveyances/vehicles (yaana-saukhyam).

हिन्दी अर्थ

[यदि] सुखेश (चतुर्थेश) (सुखेशे) केन्द्र भाव में स्थित (केन्द्रभावस्थे) हो, तथा (तथा) शुक्र (भृगौ) भी केन्द्र में स्थित (केन्द्रे स्थिते) हो, और चन्द्रमा (शशिजे) उच्च राशि में स्थित (चोच्चराशिस्थे) हो, तो बुध (बुधः) वाहन-सम्बन्धी सुख (यानसौख्यं) कहे (वदेद्)।

स्रोत: BPHS Ch.16, verse 7. PDF p.121, printed page ८९. "शशिजे" again used for the Moon (as in verse 5), rather than its more common sense of Mercury. Confirmed via scratchpad/p121-v6-7.png. Followed on the page by Hindi commentary explaining verses 1-7 (marked "॥ १-७ ॥"), then further verses continuing the chapter onto the next page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुखे मन्दो रवियुतश्चन्द्रो भाग्यगतो यदि । लाभस्थानगतो भौमो गोमहिष्यादिलाभकृत् ॥ ८ ॥

sukhe mando raviyutashchandro bhaagyagato yadi | laabhasthaanagato bhaumo gomahishyaadilaabhakrit || 8 ||

अंग्रेज़ी अर्थ

If Saturn (mandah) is in the 4th house (sukhe), [and] the Moon (chandrah) joined with the Sun (ravi-yutah) is in the 9th/fortune house (bhaagya-gatah), [and] Mars (bhaumah) is situated in the 11th/gain house (laabha-sthaana-gatah), [the native] gains cows, buffaloes, and the like (go-mahishya-aadi-laabha-krit).

हिन्दी अर्थ

यदि शनि (मन्दो) चतुर्थ भाव में (सुखे) हो, [और] सूर्य से युक्त चन्द्रमा (रवियुतश्चन्द्रो) भाग्य/नवम भाव में (भाग्यगतो) हो, [और] मंगल (भौमो) लाभ/एकादश भाव में स्थित (लाभस्थानगतो) हो, तो [जातक] गाय, भैंस आदि का लाभ (गोमहिष्यादिलाभकृत्) पाता है।

स्रोत: BPHS Ch.16, verse 8. PDF p.122 (doc index 121, printed page ९०), header "बृहत्पाराशरहोराशास्त्रम्". Confirmed via scratchpad/p122-v8-9.png, matching scratchpad/bphs-p122-overview.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुखे चरगृहासक्ते तथा तद्राशिनायके । सभौमे व्ययषष्ठस्थे मूकत्वं याति मानवः ॥ ९ ॥

sukhe charagrihaasakte tathaa tadraashinaayake | sabhaume vyayashashthasthe mookatvam yaati maanavah || 9 ||

अंग्रेज़ी अर्थ

[If] the 4th house (sukhe) is occupied by a movable/chara sign (chara-griha-aasakte) and likewise its lord (tad-raashi-naayake) [is afflicted], together with Mars (sa-bhaume) situated in the 12th or 6th house (vyaya-shashtha-sthe), the person (maanavah) becomes mute (mookatvam yaati).

हिन्दी अर्थ

यदि सुख भाव (सुखे) चर राशि में स्थित (चरगृहासक्ते) हो तथा उसका स्वामी भी (तद्राशिनायके) [पीड़ित हो], मंगल सहित (सभौमे) द्वादश या षष्ठ भाव में स्थित (व्ययषष्ठस्थे) हो, तो मनुष्य (मानवः) मूकत्व/गूंगापन को प्राप्त होता है (याति)।

स्रोत: BPHS Ch.16, verse 9. PDF p.122, printed page ९०. Word-level zoom (scratchpad/p122-v9-word2.png) corrects an initial lower-resolution misread of "शूकत्वं" to the confirmed "मूकत्वं", cross-checked against this same page's excluded Hindi commentary which explicitly glosses the condition as "जातक मूक (गूंगा) होता है" (the commentary itself is not transcribed as verse content, only consulted for confirmation per standing practice). Matches scratchpad/bphs-p122-overview.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नस्थानाधिपे सौम्ये सुखेशे नीचराशिगे । कारके व्ययभावस्थे सुखेशे लाभसंयुते ॥ १० ॥

lagnasthaanaadhipe saumye sukheshe neecharaashige | kaarake vyayabhaavasthe sukheshe laabhasanyute || 10 ||

अंग्रेज़ी अर्थ

[If] the lord of the ascendant (lagna-sthaana-adhipe) is a benefic (saumye), the lord of the 4th house (sukha-eshe) is in a debilitated sign (neecha-raashi-ge), the karaka [Moon] (kaarake) is situated in the 12th house (vyaya-bhaava-sthe), [and] the lord of the 4th (sukha-eshe) is joined with the lord of the 11th (laabha-sanyute) -- [the following results, continued in verse 11].

हिन्दी अर्थ

[यदि] लग्नाधिप (लग्नस्थानाधिपे) सौम्य ग्रह हो (सौम्ये), सुखेश (सुखेशे) नीच राशि में हो (नीचराशिगे), कारक [चन्द्रमा] (कारके) द्वादश भाव में स्थित हो (व्ययभावस्थे), और सुखेश (सुखेशे) लाभेश से युक्त हो (लाभसंयुते) -- [तो आगे वर्णित फल होता है, देखें श्लोक ११]।

स्रोत: BPHS Ch.16, verse 10. PDF p.122, printed page ९०. Confirmed via scratchpad/p122-v10-12.png, matching the overview. The word "सुखेशे" is printed at the end of both line 1 and line 2 of this verse -- an apparent repetition retained as printed per zero-fabrication discipline. This verse's syntax continues directly into verse 11. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्वादशे वत्सरे प्राप्ते वाहनस्य सुखं वदेत् । वाहने रविसंयुक्ते स्वोच्चे तद्राशिनायके ॥ ११ ॥

dvaadashe vatsare praapte vaahanasya sukham vadet | vaahane ravisanyukte svocche tadraashinaayake || 11 ||

अंग्रेज़ी अर्थ

[Continuing from verse 10:] one should predict (vadet) happiness/comfort from a vehicle (vaahanasya sukham) in the 12th year (dvaadashe vatsare praapte). [This applies] when the [4th house, signifying] vehicle (vaahane) is joined with the Sun (ravi-sanyukte), [and] its lord (tad-raashi-naayake) is in its own exaltation (sva-uchche).

हिन्दी अर्थ

[श्लोक १० से आगे:] बारहवें वर्ष में (द्वादशे वत्सरे प्राप्ते) वाहन-सुख (वाहनस्य सुखं) कहना चाहिए (वदेत्)। [यह तब होता है] जब वाहन-सूचक भाव (वाहने) सूर्य से युक्त हो (रविसंयुक्ते), और उसका स्वामी (तद्राशिनायके) अपनी उच्च राशि में हो (स्वोच्चे)।

स्रोत: BPHS Ch.16, verse 11. PDF p.122, printed page ९०. Confirmed via scratchpad/p122-v10-12.png and scratchpad/p122-v12line1.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

युते शुक्रेण यानासिद्ध्वात्रिंशे वत्सरे भवेत् । कर्मेशेन युते बन्धुनाथे तुङ्गांशसंयुते ॥ १२ ॥

yute shukrena yaanaasiddhvaatrinshe vatsare bhavet | karmeshena yute bandhunaathe tungaanshasanyute || 12 ||

अंग्रेज़ी अर्थ

[If the 4th-lord is] joined with Venus (yute shukrena), attainment of a vehicle (yaana-aasiddhih) would occur in the 32nd year (dvaatrinshe vatsare bhavet). [This applies] when [the 4th-lord] is joined with the 10th-lord (karma-eshena yute), [and] the lord of the 4th (bandhu-naathe) is joined with its own exaltation-navamsha (tungaansha-sanyute).

हिन्दी अर्थ

[यदि चतुर्थेश] शुक्र से युक्त हो (युते शुक्रेण), तो बत्तीसवें वर्ष में (द्वात्रिंशे वत्सरे) यान/वाहन की सिद्धि-प्राप्ति (यानासिद्धिः) होती है (भवेत्)। [यह तब होता है] जब [चतुर्थेश] दशमेश से युक्त हो (कर्मेशेन युते), और चतुर्थभावनाथ (बन्धुनाथे) उच्चांश/तुङ्गांश से युक्त हो (तुङ्गांशसंयुते)।

स्रोत: BPHS Ch.16, verse 12. PDF p.122, printed page ९०. Confirmed via scratchpad/p122-v12line1.png and scratchpad/p122-v12line2b.png. The printed compound "यानासिद्ध्वात्रिंशे" is transcribed exactly as set; the most plausible underlying parse is yaana + aasiddhih (attainment/accomplishment of a vehicle) + dvaatrinshe (32nd) with visarga-sandhi compressed in this edition's typesetting (expected yaanaasiddhirdvaatrinshe), cross-referenced against this page's excluded Hindi commentary which glosses the sense as "बत्तिसवें वर्ष यान की प्राप्ति होवे" (in the 32nd year, attainment of a vehicle occurs) -- the commentary itself is not transcribed as verse content, only consulted for confirmation. "बन्धुनाथे" is printed here with a clearly closed ब (unlike the व-rendered instances of this word noted elsewhere in this chapter, e.g. verse 2's "वन्धुभावगते"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्विचत्वारिंशके वर्षे नरो वाहनभाग्भवेत् । लाभेशे सुखराशिस्थे सुखेशे लाभसंयुते ॥ १३ ॥

dvichatvaarinshake varshe naro vaahanabhaagbhavet | laabheshe sukharaashisthe sukheshe laabhasanyute || 13 ||

अंग्रेज़ी अर्थ

In the 42nd year (dvichatvaarinshake varshe), a person (narah) attains a vehicle (vaahana-bhaak bhavet), [when] the lord of the 11th (laabha-eshe) is situated in the sign of the 4th (sukha-raashi-sthe), [and] the lord of the 4th (sukha-eshe) is joined with the lord of the 11th (laabha-sanyute).

हिन्दी अर्थ

बयालीसवें वर्ष में (द्विचत्वारिंशके वर्षे) मनुष्य (नरो) वाहन को प्राप्त करता है (वाहनभाग्भवेत्), [जब] लाभेश (लाभेशे) सुख-राशि में स्थित हो (सुखराशिस्थे), और सुखेश (सुखेशे) लाभेश से युक्त हो (लाभसंयुते)।

स्रोत: BPHS Ch.16, verse 13. PDF p.122, printed page ९०. Confirmed via scratchpad/p122-v13-14.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्वादशे वत्सरे प्राप्ते मानवो यानभाग्भवेत् । शुभं भावस्य संपुष्टौ दुर्वलत्वेऽन्यथा फलम् ॥ १४ ॥ इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे चतुर्थभावफलाध्यायः ॥ १६ ॥

dvaadashe vatsare praapte maanavo yaanabhaagbhavet | shubham bhaavasya sanpushtau durvalatveanyathaa phalam || 14 || iti savimarsha-sudhaavyaakhyopete brihatpaaraasharahoraashaastre chaturthabhaavaphalaadhyaayah || 16 ||

अंग्रेज़ी अर्थ

In the 12th year attained (dvaadashe vatsare praapte), a person (maanavah) becomes possessed of a vehicle (yaana-bhaak bhavet). [This is] the auspicious result (shubham phalam) when the house [4th] is strong/fortified (bhaavasya sanpushtau); otherwise (anyathaa), when weak (durvalatve), [a different] result [follows]. [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion, the chapter on the results of the 4th/happiness house (chaturtha-bhaava-phala-adhyaayah) is concluded. Chapter 16.

हिन्दी अर्थ

बारहवें वर्ष प्राप्त होने पर (द्वादशे वत्सरे प्राप्ते), मनुष्य (मानवो) वाहन को प्राप्त करने वाला होता है (यानभाग्भवेत्)। भाव के सम्पुष्ट/बलवान होने पर (भावस्य संपुष्टौ) यह शुभ फल (शुभं फलम्) है; अन्यथा (अन्यथा), दुर्बल होने पर (दुर्वलत्वे), [अन्य] फल होता है। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में चतुर्थ-भाव-फल अध्याय (चतुर्थभावफलाध्यायः) समाप्त होता है। अध्याय १६।

स्रोत: BPHS Ch.16, verse 14 (closing). PDF p.122, printed page ९०. Verse confirmed via scratchpad/p122-v13-14.png; note the printed "दुर्वलत्वे" (व rather than the expected ब of "दुर्बलत्वे") is a further instance of this edition's recurring व/ब typeface ambiguity (see also verse 2's "वन्धुभावगते", verse 5's "वन्धुपूज्यो", and Ch.15's closing colophon "वृहत्पाराशरहोराशास्त्रे"), retained as printed while the standard दुर्बलत्वे form is used in translation/translationHi per established practice. The chapter-closing colophon was confirmed via scratchpad/bphs-p122-overview.png, immediately following the Hindi commentary on verses 6-14 (marked "॥ ६-१४ ॥", excluded from transcription per copyright-safety discipline); its printed title likewise reads "बृहत्पाराशरहोराशास्त्रे" (this instance rendered with a clear ब, unlike the Ch.15 colophon's व-rendering of the same word) -- standard बृहत् form used per colophon convention regardless. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ पञ्चम (सुत) भावफलाध्यायः ॥ १७ ॥ पराशर उवाच-- अथ पञ्चमभावस्य फलं वच्मि शृणु द्विज । लग्नेशे पञ्चमेशे च पञ्चमस्थानसंस्थिते ॥ १ ॥

atha pancama (suta) bhaavaphalaadhyaayah || 17 || paraashara uvaacha-- atha pancamabhaavasya phalam vachmi shrinu dvija | lagneshe pancameshe cha pancamasthaanasansthite || 1 ||

अंग्रेज़ी अर्थ

[Chapter opening title:] Now the chapter on the results of the 5th (children/son) house. Chapter 17. Parashar said: Now I shall tell (vachmi) the result of the 5th house (pancama-bhaavasya phalam); listen (shrinu), O twice-born (dvija). [If] the lord of the ascendant (lagna-eshe) and the lord of the 5th (pancama-eshe) are both situated in the 5th house itself (pancama-sthaana-sansthite)...

हिन्दी अर्थ

[अध्याय-शीर्षक:] अब पञ्चम (सुत/सन्तान) भाव के फल का अध्याय। अध्याय १७। पराशर ने कहा: अब मैं पञ्चम भाव का फल (पञ्चमभावस्य फलं) कहता हूँ (वच्मि); हे द्विज सुनो (शृणु)। [यदि] लग्नेश (लग्नेशे) और पञ्चमेश (पञ्चमेशे) दोनों पञ्चम भाव में स्थित हों (पञ्चमस्थानसंस्थिते)...

स्रोत: BPHS Ch.17 opening + verse 1. PDF p.122 (doc index 121, printed page ९१), header "पञ्चम (सुत) भावफलाध्यायः". Chapter title, invocation "पराशर उवाच--", and verse 1 prefixed per standing chapter-opening convention. Confirmed via scratchpad/p122b-v1-2.png and scratchpad/p122c-v2b-3.png, matching scratchpad/bphs-p122-overview.png. Throughout this chapter the printed font renders the ञ्च conjunct of "पञ्चम" (fifth) with a ligature that visually resembles "श्च" (appearing as "पश्चम") -- treated as a font-rendering characteristic of this edition's ञ्च conjunct (distinct from the separate, genuine व/ब typeface ambiguity noted in earlier chapters), since "पश्चम" is not a standard term and the chapter's own title, subject matter (5th/putra house), and the text's consistent ordinal-plus-bhava chapter-naming convention make "पञ्चम" contextually certain; standardized to पञ्चम throughout this chapter with the pattern disclosed once here rather than per-verse. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

केन्द्रकोणगते वापि पूर्णपुत्रभवं सुखम् । षष्ठाष्टमव्ययगते सुतेशे स्यादपुत्रता ॥ २ ॥

kendrakonagate vaapi poornaputrabhavam sukham | shashthaashtamavyayagate suteshe syaadaputrataa || 2 ||

अंग्रेज़ी अर्थ

...or (vaapi), [if they are] situated in a kendra or trikona (kendra-kona-gate), there is complete happiness from children (poorna-putra-bhavam sukham). [If] the lord of the 5th (suta-eshe) is situated in the 6th, 8th, or 12th house (shashtha-ashtama-vyaya-gate), there would be childlessness (syaat-aputrataa).

हिन्दी अर्थ

...अथवा (वापि) केन्द्र या त्रिकोण में स्थित हों (केन्द्रकोणगते), तो पूर्ण पुत्र-सुख होता है (पूर्णपुत्रभवं सुखम्)। [यदि] सुतेश (सुतेशे) षष्ठ, अष्टम, या द्वादश भाव में स्थित हो (षष्ठाष्टमव्ययगते), तो अपुत्रता होती है (स्यादपुत्रता)।

स्रोत: BPHS Ch.17, verse 2. PDF p.122, printed page ९१. Confirmed via scratchpad/p122c-v4.png and scratchpad/p122d-v3b-4.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अस्तंगते पञ्चमेशे पापाक्रान्ते च दुर्वले । जायते न सुतस्तस्य जातोऽपि मृतिमाप्नुयात् ॥ ३ ॥

astangate pancameshe paapaakraante cha durvale | jaayate na sutastasya jaatoapi mritimaapnuyaat || 3 ||

अंग्रेज़ी अर्थ

[If] the lord of the 5th (pancama-eshe) is combust (astam-gate), afflicted by malefics (paapa-aakraante), and weak (durbale), no child (na sutah) is born (jaayate) to that person (tasya); even if born (jaatah api), it would meet death (mritim aapnuyaat).

हिन्दी अर्थ

[यदि] पञ्चमेश (पञ्चमेशे) अस्तंगत हो (अस्तंगते), पाप ग्रहों से पीड़ित हो (पापाक्रान्ते), और दुर्बल हो (दुर्वले), तो उस [जातक] के सन्तान नहीं होती (जायते न सुतस्तस्य); यदि उत्पन्न भी हो (जातोऽपि), तो वह मृत्यु को प्राप्त होती है (मृतिमाप्नुयात्)।

स्रोत: BPHS Ch.17, verse 3. PDF p.122, printed page ९१. Confirmed via scratchpad/p122d-v3b-4.png, matching the overview. The printed "दुर्वले" (व rather than the expected ब of "दुर्बले") is a further instance of this edition's recurring व/ब typeface ambiguity (see prior chapters' disclosures, e.g. Ch.16 v.2 and v.14), retained as printed while the standard दुर्बल form is used in translation/translationHi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षष्ठस्थाने सुताधीशे लग्नेशे भौमसंयुते । म्रियते प्रथमापत्यं काकवन्ध्या सधर्मिणी ॥ ४ ॥

shashthasthaane sutaadheeshe lagneshe bhaumasanyute | mriyate prathamaapatyam kaakavandhyaa sadharminee || 4 ||

अंग्रेज़ी अर्थ

[If] the lord of children (suta-adheeshe) is in the 6th house (shashtha-sthaane), [and] the lord of the ascendant (lagna-eshe) is joined with Mars (bhauma-sanyute), the firstborn child (prathama-apatyam) dies (mriyate), [and] the wife (sa-dharminee) becomes 'crow-barren' (kaaka-vandhyaa) [bears only once, then no more].

हिन्दी अर्थ

[यदि] सुताधीश (सुताधीशे) षष्ठ भाव में हो (षष्ठस्थाने), और लग्नेश (लग्नेशे) मंगल से युक्त हो (भौमसंयुते), तो प्रथम सन्तान (प्रथमापत्यं) मर जाती है (म्रियते), और पत्नी (सधर्मिणी) 'काकवन्ध्या' (एक बार सन्तान होकर पुनः बांझ) हो जाती है।

स्रोत: BPHS Ch.17, verse 4. PDF p.122, printed page ९१. Confirmed via scratchpad/p122d-v3b-4.png (line 1) and scratchpad/p122f-v4L2word.png (line 2). "काकवन्ध्या" (lit. 'crow-barren') is a standard classical term for a woman who bears one child and then becomes sterile, referenced here and confirmed via the page's own Hindi commentary use of the same term. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुताधीशो हि नीचस्थः षष्ठादित्रिकसंस्थितः । काकवन्ध्या भवेन्नारी सुते केतुबुधौ यदि ॥ ५ ॥

sutaadheesho hi neechasthah shashthaaditrikasansthitah | kaakavandhyaa bhavennaaree sute ketubudhau yadi || 5 ||

अंग्रेज़ी अर्थ

The lord of children (suta-adheeshah), being debilitated (neecha-sthah) [and] situated in the 6th and other trik houses (shashtha-aadi-trika-sansthitah) -- if Ketu and Mercury (ketu-budhau) are in the 5th house (sute), the wife (naaree) becomes 'crow-barren' (kaaka-vandhyaa bhavet).

हिन्दी अर्थ

सुताधीश (सुताधीशो) नीच राशि में हो (नीचस्थः) और षष्ठादि त्रिक भावों में स्थित हो (षष्ठादित्रिकसंस्थितः) -- यदि केतु-बुध (केतुबुधौ) पञ्चम भाव में हों (सुते), तो पत्नी (नारी) काकवन्ध्या हो जाती है (भवेन्नारी)।

स्रोत: BPHS Ch.17, verse 5. PDF p.122, printed page ९१. Confirmed via scratchpad/p122d-v5-6.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुतेशो नीचगो यत्र सुतस्थानं न पश्यति । तत्र सौरिबुधौ स्यातां काकवन्ध्यात्वमाप्नुयात् ॥ ६ ॥

sutesho neechago yatra sutasthaanam na pashyati | tatra sauribudhau syaataam kaakavandhyaatvamaapnuyaat || 6 ||

अंग्रेज़ी अर्थ

Where the lord of children (suta-eshah), being debilitated (neecha-gah), does not aspect (na pashyati) the 5th house (suta-sthaanam), [and] there (tatra) Saturn and Mercury (sauri-budhau) are situated (syaataam), [the wife] would attain the state of 'crow-barrenness' (kaaka-vandhyaatvam aapnuyaat).

हिन्दी अर्थ

जहाँ सुतेश (सुतेशो) नीच राशिगत होकर (नीचगो) पञ्चम भाव को नहीं देखता (सुतस्थानं न पश्यति), और वहाँ (तत्र) शनि-बुध (सौरिबुधौ) स्थित हों (स्यातां), तो [पत्नी] काकवन्ध्यत्व को प्राप्त होती है (काकवन्ध्यात्वमाप्नुयात्)।

स्रोत: BPHS Ch.17, verse 6. PDF p.122, printed page ९१. Confirmed via scratchpad/p122d-v6b-7.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भाग्येशो मूर्तिवर्ती च सुतशो नीचगो यदि । सुते केतुबुधौ स्यातां सुतं कष्टाद् विनिर्दिशेत् ॥ ७ ॥

bhaagyesho moortivartee cha sutasho neechago yadi | sute ketubudhau syaataam sutam kashtaad vinirdishet || 7 ||

अंग्रेज़ी अर्थ

If the lord of the 9th/fortune house (bhaagya-eshah) is combined with the body-significator [the Sun] (moorti-vartee), and the lord of children (suta-eshah, printed sutasho) is debilitated (neecha-gah), [and] Ketu and Mercury (ketu-budhau) are in the 5th house (sute), one should predict a child through difficulty (sutam kashtaat vinirdishet).

हिन्दी अर्थ

यदि भाग्येश (भाग्येशो) मूर्ति-कारक [सूर्य] से युक्त हो (मूर्तिवर्ती), और सुतेश (मुद्रित रूप सुतशो) नीचराशिगत हो (नीचगो), [तथा] केतु-बुध (केतुबुधौ) पञ्चम भाव में हों (सुते), तो कष्ट से सन्तान होना कहना चाहिए (सुतं कष्टाद् विनिर्दिशेत्)।

स्रोत: BPHS Ch.17, verse 7. PDF p.122, printed page ९१. Confirmed via scratchpad/p122f-v7full.png and scratchpad/p122g-v8.png (top line), matching the overview. The printed "सुतशो" (for the expected "सुतेशो", lord of children) is retained as printed, likely a compressed/elided rendering of the े matra in this edition's typesetting; the standard सुतेशः form is used in translation/translationHi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षष्ठादित्रिकसंस्थो वा नीचो वा शत्रुगेहगः । पञ्चमेशः पञ्चमे चेत् पुत्रं कष्टाद् विनिर्दिशेत् ॥ ८ ॥

shashthaaditrikasanstho vaa neecho vaa shatrugehagah | pancameshah pancame chet putram kashtaad vinirdishet || 8 ||

अंग्रेज़ी अर्थ

[If] the lord of the 5th (pancama-eshah) is situated in the 6th and other trik houses (shashtha-aadi-trika-sansthah), or debilitated (neechah), or in an enemy's house (shatru-geha-gah), [yet] is in the 5th house itself (pancame chet), one should predict a child through difficulty (putram kashtaat vinirdishet).

हिन्दी अर्थ

[यदि] पञ्चमेश (पञ्चमेशः) षष्ठादि त्रिक भावों में स्थित हो (षष्ठादित्रिकसंस्थो), या नीच हो (नीचो), या शत्रु के घर में हो (शत्रुगेहगः), [परन्तु] स्वयं पञ्चम भाव में हो (पञ्चमे चेत्), तो कष्ट से पुत्र होना कहना चाहिए (पुत्रं कष्टाद् विनिर्दिशेत्)।

स्रोत: BPHS Ch.17, verse 8. PDF p.122, printed page ९१. Confirmed via scratchpad/p122g-v8.png and scratchpad/p122h-v8.png, matching the overview. Followed on the page by Hindi commentary explaining verses 1-8 (marked "॥ १-८ ॥", excluded from transcription per copyright-safety discipline), which continues into further editorial discussion -- Chapter 17 therefore continues onto the next page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पुत्रस्थाने बुधक्षेत्रे मन्दक्षेत्रेऽथवा पुनः । मन्दे मान्दियुते दृष्टे तदा दत्तादयः सुताः ॥ ९ ॥

putrasthaane budhakshetre mandakshetreathavaa punah | mande maandiyute drishte tadaa dattaadayah sutaah || 9 ||

अंग्रेज़ी अर्थ

[If] the 5th house (putra-sthaane) is in Mercury's sign (budha-kshetre), or again (athavaa punah) in Saturn's sign (manda-kshetre), [and] Saturn (mande) is joined with or aspected by Gulika/Mandi (maandi-yute drishte), then an adopted child and the like (dattaadayah sutaah) [is indicated].

हिन्दी अर्थ

[यदि] पुत्रस्थान (पुत्रस्थाने) बुध की राशि में हो (बुधक्षेत्रे), अथवा पुनः (अथवा पुनः) शनि की राशि में हो (मन्दक्षेत्रे), और शनि (मन्दे) माण्डि/गुलिक से युक्त या दृष्ट हो (मान्दियुते दृष्टे), तो दत्तक आदि सन्तान (दत्तादयः सुताः) होती है।

स्रोत: BPHS Ch.17, verse 9. PDF p.123 (doc index 122, printed page ९२), header "बृहत्पाराशरहोराशास्त्रम्". Confirmed via scratchpad/p123b-v9L1.png and scratchpad/p123a-v9-10.png. "मान्दि" (Maandi/Gulika, a Parashari upagraha representing Saturn's shadow-point) is confirmed by this page's own Hindi commentary, which glosses this verse as "पञ्चम भाव पर शनि और गुलिक का संयोग या दृष्टि पड़े तो दत्तक पुत्र कहें" (the commentary itself is not transcribed as verse content, only consulted for confirmation). Matches scratchpad/bphs-p123-overview.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रविचन्द्रौ यदैकस्थावेकांशकसमन्वितौ । त्रिमातृभिरसौ किंवा द्विपित्रापि च पोष्यते ॥ १० ॥

ravichandrau yadaikasthaavekaanshakasamanvitau | trimaatribhirasau kinvaa dvipitraapi cha poshyate || 10 ||

अंग्रेज़ी अर्थ

When (yadaa) the Sun and Moon (ravi-chandrau) are together in one place (eka-sthau) and share the same navamsha (eka-anshaka-samanvitau), this person (asau) is raised by three mothers (tri-maatribhih), or (kinvaa) even by two fathers (dvi-pitraa api cha poshyate).

हिन्दी अर्थ

जब सूर्य-चन्द्र (रविचन्द्रौ) एक ही स्थान में हों (यदैकस्थौ) और एक ही नवांश से युक्त हों (एकांशकसमन्वितौ), तो यह जातक (असौ) तीन माताओं द्वारा (त्रिमातृभिः), अथवा (किंवा) दो पिताओं द्वारा भी पाला जाता है (द्विपित्रापि च पोष्यते)।

स्रोत: BPHS Ch.17, verse 10. PDF p.123, printed page ९२. Confirmed via scratchpad/p123a-v9-10.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पञ्चमे षड्ग्रहैर्युक्ते तदीशे व्ययराशिगे । लग्नेशेन्दू बलयुतौ दत्तपुत्रोदयस्तदा ॥ ११ ॥

pancame shadgrahairyukte tadeeshe vyayaraashige | lagneshendoo balayutau dattaputrodayastadaa || 11 ||

अंग्रेज़ी अर्थ

[If] the 5th house (pancame) is joined with six planets (shad-grahaih-yukte), [and] its lord (tad-eeshe) is in the 12th sign (vyaya-raashi-ge), [and] the lord of the ascendant and the Moon (lagna-esha-indoo) are both strong (bala-yutau), then (tadaa) the rise of an adopted son (datta-putra-udayah) occurs.

हिन्दी अर्थ

[यदि] पञ्चम भाव (पञ्चमे) छह ग्रहों से युक्त हो (षड्ग्रहैर्युक्ते), उसका स्वामी (तदीशे) द्वादश राशि में हो (व्ययराशिगे), और लग्नेश तथा चन्द्रमा (लग्नेशेन्दू) दोनों बलवान हों (बलयुतौ), तो तब (तदा) दत्तक पुत्र की प्राप्ति होती है (दत्तपुत्रोदयः)।

स्रोत: BPHS Ch.17, verse 11. PDF p.123, printed page ९२. Confirmed via scratchpad/p123a-v11-12.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पञ्चमे सवलैर्जीवसितज्ञैः संयुतेक्षिते । वलान्विते सुतेशे च भवेयुर्बहवः सुताः ॥ १२ ॥

pancame sabalairjeevasitajnaih sanyuteakshite | balaanvite suteshe cha bhaveyurbahavah sutaah || 12 ||

अंग्रेज़ी अर्थ

[If] the 5th house (pancame) is joined with or aspected by strong Jupiter, Venus, and Mercury (sa-balaih jeeva-sita-jnaih sanyuta-ikshite), [and] the lord of the 5th (suta-eshe) is likewise endowed with strength (bala-anvite), there would be many children (bhaveyuh bahavah sutaah).

हिन्दी अर्थ

[यदि] पञ्चम भाव (पञ्चमे) बलवान गुरु, शुक्र, बुध से युक्त या दृष्ट हो (सवलैर्जीवसितज्ञैः संयुतेक्षिते), और सुतेश (सुतेशे) भी बलयुक्त हो (वलान्विते), तो बहुत सन्तानें होती हैं (भवेयुर्बहवः सुताः)।

स्रोत: BPHS Ch.17, verse 12. PDF p.123, printed page ९२. Confirmed via scratchpad/p123a-v11-12.png and scratchpad/p123b-v12L2.png, matching the overview. The printed "सवलैर्" (for expected "सबलैर्") and "वलान्विते" (for expected "बलान्विते") are further instances of this edition's recurring व/ब typeface ambiguity (see disclosures in Ch.16-17), retained as printed while standard सबल/बल forms are used in translation/translationHi. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुतेशे शशिसंयुक्ते चन्द्रद्रेष्काणगेऽपि च । कन्यकानां तदोत्पत्तिं निर्दिशेन्मतिमान्नरः ॥ १३ ॥

sutesheshashisanyukte chandradreshkaanageapi cha | kanyakaanaam tadotpattim nirdishenmatimaannarah || 13 ||

अंग्रेज़ी अर्थ

[If] the lord of children (suta-eshe) is joined with the Moon (shashi-sanyukte), and also (api cha) situated in the Moon's decanate (chandra-drekkaana-ge), a wise person (matimaan narah) should predict the birth of daughters (kanyakaanaam tad-utpattim nirdishet).

हिन्दी अर्थ

[यदि] सुतेश (सुतेशे) चन्द्रमा से युक्त हो (शशिसंयुक्ते), और चन्द्र-द्रेष्काण में भी स्थित हो (चन्द्रद्रेष्काणगेऽपि च), तो बुद्धिमान पुरुष (मतिमान् नरः) कन्याओं की उत्पत्ति कहे (कन्यकानां तदुत्पत्तिं निर्दिशेत्)।

स्रोत: BPHS Ch.17, verse 13. PDF p.123, printed page ९२. Confirmed via scratchpad/p123a-v13.png, matching the overview. Followed by a one-line Hindi commentary marked "॥ १३ ॥" (excluded from transcription per copyright-safety discipline). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुतेशे चरराशिस्थे सुधांशौ राहुणान्विते । पुत्रस्थानं गते मन्दे परजातं वदेच्छिशुम् ॥ १४ ॥

sutesheh charaaraashisthe sudhaanshau raahunaanvite | putrasthaanam gate mande parajaatam vadechchhishum || 14 ||

अंग्रेज़ी अर्थ

[If] the lord of children (suta-eshe) is in a movable/chara sign (chara-raashi-sthe), [and] the Moon (sudhaanshau) is joined with Rahu (raahuna-anvite), [and] Saturn (mande) is situated in the 5th house (putra-sthaanam gate), one should predict a child of another's begetting (parajaatam vadet shishum) -- i.e. illegitimate.

हिन्दी अर्थ

[यदि] सुतेश (सुतेशे) चर राशि में स्थित हो (चरराशिस्थे), चन्द्रमा (सुधांशौ) राहु से युक्त हो (राहुणान्विते), और शनि (मन्दे) पुत्रस्थान में स्थित हो (पुत्रस्थानं गते), तो पर-उत्पन्न सन्तान (परजातं शिशुम्) कहनी चाहिए (वदेत्)।

स्रोत: BPHS Ch.17, verse 14. PDF p.123, printed page ९२. Confirmed via scratchpad/p123a-v14-15.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चन्द्रादष्टमगे जीवे लग्नादष्टमगे विधौ । पापखेटैरीक्षितयुते जातः स्याज्जारसम्भवः ॥ १५ ॥

chandraadashtamage jeeve lagnaadashtamage vidhau | paapakhetaireekshitayute jaatah syaajjaarasambhavah || 15 ||

अंग्रेज़ी अर्थ

[If] Jupiter (jeeve) is 8th from the Moon (chandraat ashtama-ge), [and] the Moon (vidhau) is 8th from the ascendant (lagnaat ashtama-ge), [and both are] aspected by or joined with malefic planets (paapa-khetaih eekshita-yute), the one born (jaatah) would be conceived out of wedlock (syaat jaara-sambhavah).

हिन्दी अर्थ

[यदि] गुरु (जीवे) चन्द्रमा से अष्टम स्थान में हो (चन्द्रादष्टमगे), और चन्द्रमा (विधौ) लग्न से अष्टम में हो (लग्नादष्टमगे), तथा [दोनों] पाप ग्रहों से दृष्ट या युक्त हों (पापखेटैरीक्षितयुते), तो उत्पन्न जातक (जातः) जारज सन्तान होता है (स्याज्जारसम्भवः)।

स्रोत: BPHS Ch.17, verse 15. PDF p.123, printed page ९२. Confirmed via scratchpad/p123c-v15.png, matching the overview. Verses 14-15 together are followed by a Hindi commentary block marked "॥ १४-१५ ॥" (excluded from transcription per copyright-safety discipline). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पुत्रस्थानाधिपे स्वोच्चे लग्नाच्चेद्द्वित्रिकोणगे । गुरुणा संयुते दृष्टे पुत्रभाग्यमुपैति सः ॥ १६ ॥

putrasthaanaadhipe svochche lagnaachcheddvitrikonage | gurunaa sanyute drishte putrabhaagyamupaiti sah || 16 ||

अंग्रेज़ी अर्थ

[If] the lord of the 5th house (putra-sthaana-adhipe) is in its own exaltation (sva-uchche), and if [it is] in the 2nd or a trikona from the ascendant (lagnaat chet dvi-trikona-ge), [and] joined with or aspected by Jupiter (guruna sanyute drishte), he (sah) attains fortune through children (putra-bhaagyam upaiti).

हिन्दी अर्थ

[यदि] पुत्रस्थान का स्वामी (पुत्रस्थानाधिपे) अपनी उच्च राशि में हो (स्वोच्चे), और लग्न से द्वितीय या त्रिकोण में हो (लग्नाच्चेद्द्वित्रिकोणगे), तथा गुरु से युक्त या दृष्ट हो (गुरुणा संयुते दृष्टे), तो वह (सः) पुत्र-भाग्य को प्राप्त होता है (पुत्रभाग्यमुपैति)।

स्रोत: BPHS Ch.17, verse 16. PDF p.123, printed page ९२. Confirmed via scratchpad/p123a-v16.png, matching the overview. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

त्रिचतुःपापसंयुक्ते पञ्चमे शुभवर्जिते । नीचगे पञ्चमेशे च नीचसंस्थो भवेच्छिशुः ॥ १९ ॥

trichatuhpaapasanyukte pancame shubhavarjite | neechage pancameshe cha neechasantho bhavechchhishuh || 19 ||

अंग्रेज़ी अर्थ

[If] the 5th house (pancame), devoid of benefics (shubha-varjite), is joined with three or four malefic planets (tri-chatuh-paapa-sanyukte), and debilitated (neechage), [and] the lord of the 5th (pancama-eshe) is also situated in debilitation (neecha-santhah), the child born (bhavet shishuh) [is afflicted accordingly].

हिन्दी अर्थ

[यदि] पञ्चम भाव (पञ्चमे), शुभ ग्रहों से रहित (शुभवर्जिते), तीन-चार पाप ग्रहों से युक्त हो (त्रिचतुःपापसंयुक्ते), और नीचराशिगत हो (नीचगे), तथा पञ्चमेश (पञ्चमेशे) भी नीच राशि में स्थित हो (नीचसंस्थो), तो सन्तान (शिशुः) [तदनुसार पीड़ित] होती है (भवेत्)।

स्रोत: BPHS Ch.17, this verse. PDF p.123, printed page ९२. Confirmed via scratchpad/p123-v19num.png, matching the overview. Verse-numbering anomaly disclosed: the printed numeral reads "१९" (19), but this couplet is the very next shloka after verse 16 with no intervening verses printed on the page (the immediately preceding Hindi commentary blocks are explicitly marked with contiguous ranges "॥ ९-१२ ॥", "॥ १३ ॥", "॥ १४-१५ ॥", and verse 16 stands alone) -- consistent with the same kind of printer's verse-numbering slip disclosed for BPHS Ch.14 v.12 (printed "१६" for what was contextually verse 12). This verse is catalogued here as 17.17, continuing the correct sequential count from verse 16, with the printed "१९" retained as printed and disclosed rather than silently corrected. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पुत्रस्थानं गते जीवे तदीशे भृगुसंयुते । द्वात्रिंशे च त्रयस्त्रिंशे वत्सरे जायते सुतः ॥ १८ ॥

putrasthaanam gate jeeve tadeeshe bhrigusanyute | dvaatrimshe cha trayastrimshe vatsare jaayate sutah || 18 ||

अंग्रेज़ी अर्थ

[If] Jupiter (jeeve) is situated in the 5th house (putra-sthaanam gate), [and] its lord (tad-eeshe) is joined with Venus (bhrigu-sanyute), a son (sutah) is born (jaayate) in the 32nd or 33rd year (dvaatrimshe cha trayastrimshe vatsare).

हिन्दी अर्थ

[यदि] गुरु (जीवे) पुत्रस्थान में स्थित हो (पुत्रस्थानं गते), और उसका स्वामी (तदीशे) शुक्र से युक्त हो (भृगुसंयुते), तो बत्तीसवें या तैंतीसवें वर्ष में (द्वात्रिंशे च त्रयस्त्रिंशे वत्सरे) पुत्र उत्पन्न होता है (जायते सुतः)।

स्रोत: BPHS Ch.17, verse 18. PDF p.124 (doc index 123, printed page ९३/93), header "पञ्चम (सुत) भावफलाध्यायः" -- continues directly from PDF p.123 (verse 17, printed numeral "१९"). The commentary immediately preceding this verse on this page is explicitly marked with range "॥ १६-१७ ॥", independently confirming that the prior page's printed "१९" numeral was a printer's slip for the contextually correct "१७" (see disclosure on ref 17.17). Confirmed via scratchpad/p124-v18-19.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुतेशे केन्द्रभावस्थे कारकेण समन्विते । षट्त्रिंशे त्रिंशदब्दे च पुत्रोत्पत्तिं विनिर्दिशेत् ॥ १९ ॥

suteshe kendrabhaavasthe kaarakena samanvite | shattrimshe trimshadabde cha putrotpattim vinirdishet || 19 ||

अंग्रेज़ी अर्थ

[If] the lord of children (suta-eshe) is situated in a kendra/angular house (kendra-bhaava-sthe), joined with the significator [Jupiter] (kaarakena samanvite), one should predict the birth of a son (putra-utpattim vinirdishet) in the 36th or 30th year (shat-trimshe trimshad-abde cha).

हिन्दी अर्थ

[यदि] सुतेश (सुतेशे) केन्द्र भाव में स्थित हो (केन्द्रभावस्थे), कारक ग्रह [गुरु] से युक्त हो (कारकेण समन्विते), तो छत्तीसवें या तीसवें वर्ष में (षट्त्रिंशे त्रिंशदब्दे च) पुत्रोत्पत्ति कहनी चाहिए (पुत्रोत्पत्तिं विनिर्दिशेत्)।

स्रोत: BPHS Ch.17, verse 19 (printed numeral matches sequential count here, unlike the anomaly on the prior page). PDF p.124, printed page ९३. Confirmed via scratchpad/p124-v18-19.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नाद् भाग्यगते जीवे जीवाद् भाग्यगते भृगौ । लग्नेशे भृगुयुक्ते वा चत्वारिंशे सुतो भवेत् ॥ २० ॥

lagnaad bhaagyagate jeeve jeevaad bhaagyagate bhrigau | lagneshe bhriguyukte vaa chatvaarimshe suto bhavet || 20 ||

अंग्रेज़ी अर्थ

[If] Jupiter (jeeve) is in the 9th from the ascendant (lagnaat bhaagya-gate), [and] Venus (bhrigau) is in the 9th from Jupiter (jeevaat bhaagya-gate), or (vaa) the lord of the ascendant (lagna-eshe) is joined with Venus (bhrigu-yukte), a son (sutah) is born (bhavet) in the 40th year (chatvaarimshe).

हिन्दी अर्थ

[यदि] गुरु (जीवे) लग्न से नवम स्थान में हो (लग्नाद् भाग्यगते), शुक्र (भृगौ) गुरु से नवम में हो (जीवाद् भाग्यगते), अथवा (वा) लग्नेश (लग्नेशे) शुक्र से युक्त हो (भृगुयुक्ते), तो चालीसवें वर्ष में (चत्वारिंशे) पुत्र होता है (सुतो भवेत्)।

स्रोत: BPHS Ch.17, verse 20. PDF p.124, printed page ९३. Confirmed via scratchpad/p124-v20-21.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पुत्रस्थानं गते राहौ तदीशे पापसंयुते । नीचराशिगतो जीवो द्वात्रिंशे पुत्रमृत्युदः ॥ २१ ॥

putrasthaanam gate raahau tadeeshe paapasanyute | neecharaashigato jeevo dvaatrimshe putramrityudah || 21 ||

अंग्रेज़ी अर्थ

[If] Rahu (raahau) is situated in the 5th house (putra-sthaanam gate), its lord (tad-eeshe) is joined with malefics (paapa-sanyute), [and] Jupiter (jeevah) is in debilitation (neecha-raashi-gatah), [this] causes the death of a son (putra-mrityu-dah) in the 32nd year (dvaatrimshe).

हिन्दी अर्थ

[यदि] राहु (राहौ) पुत्रस्थान में स्थित हो (पुत्रस्थानं गते), उसका स्वामी (तदीशे) पाप ग्रहों से युक्त हो (पापसंयुते), और गुरु (जीवः) नीच राशि में स्थित हो (नीचराशिगतः), तो बत्तीसवें वर्ष में (द्वात्रिंशे) पुत्र की मृत्यु होती है (पुत्रमृत्युदः)।

स्रोत: BPHS Ch.17, verse 21. PDF p.124, printed page ९३. Confirmed via scratchpad/p124-v20-21.png and scratchpad/p124-v21L2.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नात् पञ्चमगे पापे जीवात् पञ्चमगेऽपि च । षट्त्रिंशे च त्रयस्त्रिंशे चत्वारिंशे सुतक्षयः ॥ २२ ॥

lagnaat pancamage paape jeevaat pancamageapi cha | shattrimshe cha trayastrimshe chatvaarimshe sutakshayah || 22 ||

अंग्रेज़ी अर्थ

[If] a malefic (paape) is in the 5th from the ascendant (lagnaat pancama-ge), and also (api cha) in the 5th from Jupiter (jeevaat pancama-ge), the loss of a son (suta-kshayah) [occurs] in the 36th, 33rd, or 40th year (shat-trimshe cha trayastrimshe chatvaarimshe).

हिन्दी अर्थ

[यदि] पाप ग्रह (पापे) लग्न से पञ्चम में हो (लग्नात् पञ्चमगे), और गुरु से भी पञ्चम में हो (जीवात् पञ्चमगेऽपि च), तो छत्तीसवें, तैंतीसवें, या चालीसवें वर्ष में (षट्त्रिंशे च त्रयस्त्रिंशे चत्वारिंशे) पुत्र की हानि होती है (सुतक्षयः)।

स्रोत: BPHS Ch.17, verse 22. PDF p.124, printed page ९३. Confirmed via scratchpad/p124-v22-23.png, matching this edition's recurring ञ्च-conjunct font-ligature (पञ्चमगे renders resembling पश्चमगे, disclosed once for this chapter at ref 17.1), standardized here to पञ्चम. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्ने मान्दिसमायुक्ते लग्नेशे नीचराशिगे । षट्पञ्चाशन्मितेऽब्दे तु पुत्रशोकसमाकुलः ॥ २३ ॥

lagne maandisamaayukte lagneshe neecharaashige | shatpancaashanmiteabde tu putrashokasamaakulah || 23 ||

अंग्रेज़ी अर्थ

[If] the ascendant (lagne) is joined with Gulika/Mandi (maandi-samaayukte), [and] the lord of the ascendant (lagna-eshe) is debilitated (neecha-raashi-ge), then in the year numbering fifty-six (shat-pancaashat-mite abde), [the native is] overwhelmed with grief for a son (putra-shoka-samaakulah).

हिन्दी अर्थ

[यदि] लग्न (लग्ने) माण्डि/गुलिक से युक्त हो (मान्दिसमायुक्ते), और लग्नेश (लग्नेशे) नीच राशि में स्थित हो (नीचराशिगे), तो छप्पनवें वर्ष में (षट्पञ्चाशन्मितेऽब्दे), [जातक] पुत्र-शोक से आकुल होता है (पुत्रशोकसमाकुलः)।

स्रोत: BPHS Ch.17, verse 23. PDF p.124, printed page ९३. Confirmed via scratchpad/p124-v22-23.png, scratchpad/p124-v23L2b.png and scratchpad/p124-v23word.png. "षट्पञ्चाशन्" (56) shows the same ञ्च-ligature pattern noted at ref 17.1 (rendering close to षट्पश्चाशन्). The word printed at the end of the second line reads clearly as "पुत्रशोकयमाकुलः" -- a further visual ambiguity in this edition's font between स and य (distinct from the established व/ब ambiguity), retained here in standardized form as "पुत्रशोकसमाकुलः" ("समाकुल", overwhelmed/afflicted, being the well-attested Sanskrit word, versus "यमाकुल" which is not), cross-referenced against this page's own Hindi commentary describing "५६ वें वर्ष में पुत्र का निधनजन्य शोक होता है" (grief born of the son's death occurs in the 56th year), confirming the sense of "शोक" (grief). "मान्दि" again denotes Gulika/Mandi per the ref 17.9 disclosure. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चतुर्थे पापसंयुक्ते षष्ठेऽपि च तथाविधे । सुतेशे परमोच्चस्थे लग्नेशेन समन्विते ॥ २४ ॥

chaturthe paapasanyukte shashtheapi cha tathaavidhe | suteshe paramochchasthe lagneshena samanvite || 24 ||

अंग्रेज़ी अर्थ

[If] the 4th house (chaturthe) is joined with malefics (paapa-sanyukte), and likewise (tathaa-vidhe) also (api cha) the 6th (shashthe), [and] the lord of children (suta-eshe) is deeply exalted (paramochcha-sthe), joined with the lord of the ascendant (lagna-eshena samanvite) -- [the count of sons is ten, per the following verse's continuation].

हिन्दी अर्थ

[यदि] चतुर्थ भाव (चतुर्थे) पाप ग्रहों से युक्त हो (पापसंयुक्ते), और इसी प्रकार षष्ठ भाव भी (षष्ठेऽपि च तथाविधे), तथा सुतेश (सुतेशे) परम उच्च राशि में हो (परमोच्चस्थे), लग्नेश से युक्त हो (लग्नेशेन समन्विते) -- [सन्तानों की संख्या अगले श्लोक में बताई गई है]।

स्रोत: BPHS Ch.17, verse 24, first of a two-verse construction continuing into verse 25 (a dashaadi-bahusankhyaka-putrayoga -- combination for a specific count of many sons). PDF p.124, printed page ९३, preceded by the sub-heading "दशादि-बहुसंख्यक पुत्रयोग--" (combinations for ten-plus sons). Confirmed via scratchpad/p124-v24-26.png and scratchpad/p124-v25full.png. The syntax of this verse completes with verse 25's second line; the translation of the full construction (count of ten sons under a benefic significator) is given at ref 17.25. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कारके शुभसंयुक्ते दशसंख्यास्तु स्तनवः । परमोच्चगते जीवे धनेशे राहुसंयुते ॥ २५ ॥

kaarake shubhasanyukte dashasankhyaastu stanavah | paramochchagate jeeve dhaneshe raahusanyute || 25 ||

अंग्रेज़ी अर्थ

[With] the significator [Jupiter] (kaarake) joined with benefics (shubha-sanyukte), the number of sons (santaanaah) is ten (dasha-sankhyaa-astu) [completing verse 24's conditions]. [Further:] Jupiter (jeeve) deeply exalted (paramochcha-gate), [and] the lord of wealth (dhana-eshe) joined with Rahu (raahu-sanyute) [continues into verse 26].

हिन्दी अर्थ

कारक ग्रह [गुरु] (कारके) शुभ ग्रहों से युक्त हो (शुभसंयुक्ते) तो सन्तानों की संख्या दस होती है (दशसंख्यास्तु सन्तानाः) [श्लोक २४ की शर्तें पूर्ण होने पर]। [आगे:] गुरु (जीवे) परम उच्च राशि में हो (परमोच्चगते), और धनेश (धनेशे) राहु से युक्त हो (राहुसंयुते) [श्लोक २६ में आगे]।

स्रोत: BPHS Ch.17, verse 25. PDF p.124, printed page ९३. Confirmed via scratchpad/p124-v25full.png and scratchpad/p124-v25L1wide2.png. The word ending the first line is printed clearly as "स्तनवः" -- retained as printed since the glyph is unambiguous, though grammatically the expected sense in context (following "दशसंख्या", a count of ten, paired with "नव"/nine in the parallel verse 26) is "children/offspring" (a poetic sense related to "तनय"/तनु"); rendered accordingly in translation as "sons" without asserting a definitive grammatical derivation. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भाग्येशे भाग्यसंयुक्ते संख्याता नव स्तनवः । पुत्रभाग्यगते जीवे सुतेशे बलसंयुते ॥ २६ ॥

bhaagyeshe bhaagyasanyukte sankhyaataa nava stanavah | putrabhaagyagate jeeve suteshe balasanyute || 26 ||

अंग्रेज़ी अर्थ

[If] the lord of the 9th house (bhaagya-eshe) is joined with the 9th house/its significations (bhaagya-sanyukte), the count of sons (santaanaah) is reckoned as nine (sankhyaataa nava). [Further:] Jupiter (jeeve) situated in the 9th from the 5th house (putra-bhaagya-gate), [and] the lord of children (suta-eshe) endowed with strength (bala-sanyute) [confirms the same].

हिन्दी अर्थ

[यदि] भाग्येश (भाग्येशे) भाग्य भाव से युक्त हो (भाग्यसंयुक्ते), तो सन्तानों की संख्या नौ मानी जाती है (संख्याता नव सन्तानाः)। [आगे:] गुरु (जीवे) पञ्चम से नवम स्थान में स्थित हो (पुत्रभाग्यगते), और सुतेश (सुतेशे) बलयुक्त हो (बलसंयुते) [तो भी यही फल होता है]।

स्रोत: BPHS Ch.17, verse 26. PDF p.124, printed page ९३. Confirmed via scratchpad/p124-v26-27.png. This verse closes the visible text on this page (bottom margin follows, no further verse or commentary; see scratchpad/p124-tail.png), so Chapter 17 continues on the next page. Same "स्तनवः" form as verse 25 (see disclosure at ref 17.25). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

धनेशे कर्मभावस्थे वसुसंख्यास्तु स्तनवः । पञ्चमात् पञ्चमे मन्दे सुतस्थे च तदीश्वरे ॥ २७ ॥

dhaneshe karmabhaavasthe vasusankhyaastu stanavah | pancamaat pancame mande sutasthe cha tadeeshvare || 27 ||

अंग्रेज़ी अर्थ

[If] the lord of wealth [2nd lord] (dhana-eshe) is situated in the 10th house (karma-bhaava-sthe), the number of sons is eight (vasu-sankhyaa-astu), [when] Saturn (mande) is 5th from the 5th (pancamaat pancame), and its lord (tad-eeshvare) is situated in the 5th [house of children] (suta-sthe).

हिन्दी अर्थ

[यदि] धनेश (धनेशे) कर्म भाव (दशम) में स्थित हो (कर्मभावस्थे), तो सन्तानों की संख्या आठ होती है (वसुसंख्यास्तु), जब शनि (मन्दे) पञ्चम से पञ्चम में हो (पञ्चमात् पञ्चमे), और उसका स्वामी (तदीश्वरे) पञ्चम भाव में स्थित हो (सुतस्थे)।

स्रोत: BPHS Ch.17, verse 27, opening a further dashaadi-bahusankhyaka-putrayoga continuation. PDF p.125 (doc index 124, printed page ९४/94), header "बृहत्पाराशरहोराशास्त्रम्". Confirmed via scratchpad/p125-v27L1.png and scratchpad/p125-v27-28.png. "स्तनवः" again as in refs 17.25-17.26 (see disclosure there). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्तनवः सप्तसंख्याश्च द्विगर्भे यमलं भवेत् । वित्तेशे पञ्चमस्थे च सुतस्थे पञ्चमाधिपे ॥ २८ ॥

stanavah saptasankhyaashcha dvigarbhe yamalam bhavet | vitteshe pancamasthe cha sutasthe pancamaadhipe || 28 ||

अंग्रेज़ी अर्थ

The sons number seven (santaanaah sapta-sankhyaah cha), and there occurs a twin birth in one womb (dvi-garbhe yamalam bhavet), when the lord of wealth [2nd lord] (vitta-eshe) is situated in the 5th (pancama-sthe), and the lord of the 5th (pancama-adhipe) is likewise situated in the 5th [house of children] (suta-sthe).

हिन्दी अर्थ

सन्तानों की संख्या सात होती है (स्तनवः सप्तसंख्याश्च), और एक ही गर्भ में युगल (जुड़वां) सन्तान होती है (द्विगर्भे यमलं भवेत्), जब वित्तेश (वित्तेशे) पञ्चम भाव में स्थित हो (पञ्चमस्थे), और पञ्चमेश (पञ्चमाधिपे) भी पञ्चम भाव में स्थित हो (सुतस्थे)।

स्रोत: BPHS Ch.17, verse 28. PDF p.125, printed page ९४. Confirmed via scratchpad/p125-v27-28.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षट्संख्याकसुतप्राप्तिस्तेषां च त्रिप्रजाच्युतिः । मन्दात् पञ्चमगे जीवे जीवाद् वा पञ्चमे शनौ ॥ २९ ॥

shatsankhyaakasutapraaptisteshaam cha triprajaachyutih | mandaat pancamage jeeve jeevaad vaa pancame shanau || 29 ||

अंग्रेज़ी अर्थ

The attainment of six sons occurs (shat-sankhyaaka-suta-praaptih), of whom three offspring perish (teshaam cha tri-prajaa-chyutih), when Jupiter (jeeve) is 5th from Saturn (mandaat pancama-ge), or (vaa) Saturn (shanau) is 5th from Jupiter (jeevaat pancame).

हिन्दी अर्थ

छह सन्तानों की प्राप्ति होती है (षट्संख्याकसुतप्राप्तिः), जिनमें से तीन सन्तानों का नाश होता है (तेषां च त्रिप्रजाच्युतिः), जब गुरु (जीवे) शनि से पञ्चम में हो (मन्दात् पञ्चमगे), अथवा (वा) शनि (शनौ) गुरु से पञ्चम में हो (जीवाद् पञ्चमे)।

स्रोत: BPHS Ch.17, verse 29. PDF p.125, printed page ९४. Confirmed via scratchpad/p125-v29-30.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पञ्चमे पापसंयुक्ते पुत्रमेकं विनिर्दिशेत् । पञ्चमे पापसंयुक्ते गुरोः पञ्चमगे शनौ ॥ ३० ॥

pancame paapasanyukte putramekam vinirdishet | pancame paapasanyukte guroh pancamage shanau || 30 ||

अंग्रेज़ी अर्थ

[If] the 5th house (pancame) is joined with malefics (paapa-sanyukte), one should predict a single son (putram ekam vinirdishet); likewise when the 5th (pancame) is joined with malefics (paapa-sanyukte) and Saturn (shanau) is 5th from Jupiter (guroh pancama-ge).

हिन्दी अर्थ

[यदि] पञ्चम भाव (पञ्चमे) पाप ग्रहों से युक्त हो (पापसंयुक्ते), तो एक पुत्र कहना चाहिए (पुत्रमेकं विनिर्दिशेत्); इसी प्रकार जब पञ्चम (पञ्चमे) पाप ग्रहों से युक्त हो (पापसंयुक्ते) और शनि (शनौ) गुरु से पञ्चम में हो (गुरोः पञ्चमगे)।

स्रोत: BPHS Ch.17, verse 30. PDF p.125, printed page ९४. Confirmed via scratchpad/p125-v30L1.png and scratchpad/p125-v31-32.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जायान्तरे पुत्रलाभः कलत्रत्रयभाग् भवेत् । पञ्चमे पापसंयुक्ते जीवात् पञ्चमगे शनौ ॥ ३१ ॥

jaayaantare putralaabhah kalatratrayabhaag bhavet | pancame paapasanyukte jeevaat pancamage shanau || 31 ||

अंग्रेज़ी अर्थ

The gain of a son occurs through another wife (jaayaa-antare putra-laabhah), [and the native] will possess three wives (kalatra-traya-bhaak bhavet), when the 5th (pancame) is joined with malefics (paapa-sanyukte) and Saturn (shanau) is 5th from Jupiter (jeevaat pancama-ge).

हिन्दी अर्थ

दूसरी पत्नी से पुत्र-लाभ होता है (जायान्तरे पुत्रलाभः), [जातक] तीन पत्नियों वाला होता है (कलत्रत्रयभाग् भवेत्), जब पञ्चम (पञ्चमे) पाप ग्रहों से युक्त हो (पापसंयुक्ते) और शनि (शनौ) गुरु से पञ्चम में हो (जीवात् पञ्चमगे)।

स्रोत: BPHS Ch.17, verse 31. PDF p.125, printed page ९४. Confirmed via scratchpad/p125-v31-32.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नेशे धनभावस्थे, पञ्चमेशः कुजान्वितः । जातं जातं शिशुं हन्ति दीर्घायुश्चैव मानवः ॥ ३२ ॥ इति सविमर्श-सुधाव्याख्योपेते वृहत्पाराशरहोराशास्त्रे पञ्चमभावफलाध्यायः ॥ १७ ॥

lagneshe dhanabhaavasthe, pancameshah kujaanvitah | jaatam jaatam shishum hanti deerghaayushchaiva maanavah || 32 || iti savimarsha-sudhaavyaakhyopete vrihatpaaraasharahoraashaastre pancamabhaavaphalaadhyaayah || 17 ||

अंग्रेज़ी अर्थ

[If] the lord of the ascendant (lagna-eshe) is situated in the 2nd house (dhana-bhaava-sthe), [and] the lord of the 5th (pancama-eshah) is joined with Mars (kuja-anvitah), [this] destroys each child in succession as it is born (jaatam jaatam shishum hanti), though the person himself lives long (deerghaayuh cha eva maanavah). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion, the chapter on the results of the 5th house (pancama-bhaava-phala-adhyaayah) is concluded. Chapter 17.

हिन्दी अर्थ

[यदि] लग्नेश (लग्नेशे) धन भाव (द्वितीय) में स्थित हो (धनभावस्थे), और पञ्चमेश (पञ्चमेशः) मंगल से युक्त हो (कुजान्वितः), तो प्रत्येक उत्पन्न सन्तान की क्रमशः मृत्यु होती है (जातं जातं शिशुं हन्ति), किन्तु मनुष्य स्वयं दीर्घायु होता है (दीर्घायुश्चैव मानवः)। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में पञ्चम-भाव-फल अध्याय (पञ्चमभावफलाध्यायः) समाप्त होता है। अध्याय १७।

स्रोत: BPHS Ch.17, verse 32, closing the dashaadi-bahusankhyaka-putrayoga sub-section (verses 24-32). PDF p.125, printed page ९४. Confirmed via scratchpad/p125-v32.png and scratchpad/p125-v32L2.png. Followed by a Hindi commentary block marked "॥ २४-३२ ॥", then a "विमर्श" (discussion) section quoting a citation from another classical source (excluded from transcription per copyright-safety discipline), then three further pages of the editor's own Hindi prose (PDF pp.126-128, printed pages ९५-९७) covering supplementary "vidyaa" (learning) yogas citing other jaataka texts, then a "सन्ततिविचार" (progeny) discursive section and a "सन्तान संख्या" (count of children) discursive section -- all editorial prose synthesis with no verse numbers, excluded from transcription. The chapter-closing colophon was confirmed via scratchpad/bphs-p128-overview.png and the zoom crops scratchpad/p128-colophon2.png and scratchpad/p128-colophon-word1.png, on PDF p.128 (printed page ९७/97), immediately following the numbered prose item (9) on santaan-sankhyaa. The colophon's printed "वृहत्पाराशरहोराशास्त्रे" uses व rather than the expected ब of "बृहत्...", consistent with this edition's recurring व/ब typeface ambiguity seen at the Ch.15 and Ch.16 colophons; retained as printed in sanskrit/iast while the standard "brihat" form is used in the translation/translationHi per established practice. Chapter 17's topic ("pancama-bhaava-phala", 5th-house results/progeny) matches its colophon title, confirming no misnumbering. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ षष्ठ (रोगादि) भावफलाध्यायः ॥ १८ ॥ पराशर उवाच-- अथ वच्मि फलं षष्ठभावगं ते मुनेऽधुना । येन ज्ञास्यसि जातस्य देहे रोग-व्रणादिकम् ॥ १ ॥

atha shashtha (rogaadi) bhaavaphalaadhyaayah || 18 || paraashara uvaacha-- atha vachmi phalam shashthabhaavagam te muneadhunaa | yena jnaasyasi jaatasya dehe roga-vranaadikam || 1 ||

अंग्रेज़ी अर्थ

[Chapter 18: Now the chapter on the results of the sixth (disease, etc.) house.] Parashar said -- Now I shall tell you, O sage (te mune), the result pertaining to the sixth house (shashtha-bhaava-gam phalam), by which you shall know (yena jnaasyasi) the diseases and wounds etc. (roga-vrana-aadikam) on the body of the native (jaatasya dehe).

हिन्दी अर्थ

[अध्याय १८: अब षष्ठ (रोगादि) भाव के फल का अध्याय।] पराशर ने कहा -- हे मुने! अब मैं षष्ठ भाव सम्बन्धी फल कहता हूँ (अथ वच्मि फलं षष्ठभावगं), जिससे तुम जातक के शरीर में होने वाले रोग-व्रण आदि को जान सकोगे (येन ज्ञास्यसि जातस्य देहे रोग-व्रणादिकम्)।

स्रोत: BPHS Ch.18, opening + verse 1. PDF p.129 (doc index 128, xref 387), printed page ९८/98, header "बृहत्पाराशरहोराशास्त्रम्". Confirmed via scratchpad/bphs-p129-overview.png and scratchpad/p129-v1-3.png. Chapter title/invocation prefixed to verse 1 per established convention. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्वभे षष्ठाधिपः पापो देहे वाऽप्यष्टमे स्थितः । तदा भवेद् व्रणो देहे भावराशिगतेऽङ्गके ॥ २ ॥

svabhe shashthaadhipah paapo dehe vaapyashtame sthitah | tadaa bhaved vrano dehe bhaavaraashigateaangake || 2 ||

अंग्रेज़ी अर्थ

[If] the lord of the 6th (shashtha-adhipah), being a malefic (paapah), is situated in its own house (sva-bhe) or (vaa api) in the 8th (ashtame sthitah), then a wound occurs (tadaa bhavet vranah) on the body (dehe), on the limb/part (angake) signified by the sign occupied by the [6th] house (bhaava-raashi-gate).

हिन्दी अर्थ

[यदि] षष्ठेश (षष्ठाधिपः), पाप ग्रह होकर (पापः), अपने भाव में (स्वभे) या (वा अपि) अष्टम भाव में स्थित हो (अष्टमे स्थितः), तो शरीर में (देहे) व्रण होता है (तदा भवेद् व्रणो), उस अंग में जो षष्ठ भाव की राशि से सूचित होता है (भावराशिगतेऽङ्गके)।

स्रोत: BPHS Ch.18, verse 2. PDF p.129, printed page ९८. Confirmed via scratchpad/p129-v2-3.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एवं पित्रादि-भावेशास्तत्तत्कारक-संयुताः । व्रणाधिपयुताश्चापि षष्ठाष्टम-युता यदि ॥ ३ ॥

evam pitraadi-bhaaveshaastattatkaaraka-sanyutaah | vranaadhipayutaashchaapi shashthaashtama-yutaa yadi || 3 ||

अंग्रेज़ी अर्थ

Likewise (evam), the lords of the houses of the father etc. (pitra-aadi-bhaava-eshaah), joined with their respective significators (tat-tat-kaaraka-sanyutaah), and also (cha api) joined with the lord of a wound (vrana-adhipa-yutaah), if (yadi) connected with the 6th/8th (shashtha-ashtama-yutaah) [likewise cause a wound to the relevant relative].

हिन्दी अर्थ

इसी प्रकार (एवं), पिता आदि भावों के स्वामी (पित्रादि-भावेशाः), अपने-अपने कारक ग्रहों से युक्त होकर (तत्तत्कारक-संयुताः), और व्रण के स्वामी से भी युक्त होकर (व्रणाधिपयुताश्चापि), यदि षष्ठ-अष्टम से युक्त हों (षष्ठाष्टम-युता यदि), [तो सम्बन्धित व्यक्ति को भी व्रण होता है]।

स्रोत: BPHS Ch.18, verse 3. PDF p.129, printed page ९८. Confirmed via scratchpad/p129-v3-4.png. The bracketed completion of sense in the translation follows the page's own Hindi commentary explaining this verse ("पित्रादिकों को व्रणादि कहना"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

तेषामपि व्रणं वाच्य-मादित्येन शिरोव्रणम् । इन्दुना च मुखे कण्ठे भौमेन ज्ञेन नाभिषु ॥ ४ ॥

teshaamapi vranam vaachya-maadityena shirovranam | indunaa cha mukhe kanthe bhaumena jnena naabhishu || 4 ||

अंग्रेज़ी अर्थ

Of these too (teshaam api), the wound (vranam) is to be told (vaachyam) -- by the Sun (aadityena), a head-wound (shiro-vranam); by the Moon (indunaa), on the face (mukhe); by Mars (bhaumena), on the throat (kanthe); by Mercury (jnena), on the navel (naabhishu).

हिन्दी अर्थ

इनका भी व्रण (तेषामपि व्रणं) कहना चाहिये (वाच्यम्) -- सूर्य से (आदित्येन) सिर का व्रण (शिरोव्रणम्); चन्द्रमा से (इन्दुना) मुख पर (मुखे); मंगल से (भौमेन) कण्ठ पर (कण्ठे); बुध से (ज्ञेन) नाभि पर (नाभिषु)।

स्रोत: BPHS Ch.18, verse 4. PDF p.129, printed page ९८. Confirmed via scratchpad/p129-v3-4.png. Note the printed order names Mars for the throat and pairs Moon with the face -- retained exactly as printed, cross-checked against the page's own Hindi commentary ("चन्द्रमा हो तो मुखव्रण, मंगल हो तो कण्ठव्रण... बुध हो तो नाभिगत व्रण"). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गुरुणा नासिकायां च भृगुणा नयने पदे । शशिना राहुणा कुक्षौ केतुना च तथा भवेत् ॥ ५ ॥

gurunaa naasikaayaam cha bhrigunaa nayane pade | shashinaa raahunaa kukshau ketunaa cha tathaa bhavet || 5 ||

अंग्रेज़ी अर्थ

By Jupiter (gurunaa), on the nose (naasikaayaam); by Venus (bhrigunaa), on the eye [or] foot (nayane pade); by the Moon [-- as read in this line] and by Rahu (shashinaa raahunaa), on the flank (kukshau); and by Ketu (ketunaa), it would likewise be [on the stomach] (tathaa bhavet).

हिन्दी अर्थ

गुरु से (गुरुणा) नासिका पर (नासिकायां); शुक्र से (भृगुणा) नेत्र अथवा पैर पर (नयने पदे); चन्द्रमा और राहु से (शशिना राहुणा) कुक्षि (कोख/पार्श्व) पर (कुक्षौ); और केतु से (केतुना च) उसी प्रकार [उदर पर] होता है (तथा भवेत्)।

स्रोत: BPHS Ch.18, verse 5. PDF p.129, printed page ९८. Confirmed via scratchpad/p129-v5-6.png. The pairing of "शशिना राहुणा" (Moon and Rahu together) for one body part, with the exact sense of "तथा भवेत्" for Ketu left implicit, is retained as printed; the page's own Hindi commentary clarifies the intended fuller scheme as: Jupiter=nose, Venus=eye, Saturn=foot, Rahu/Ketu=stomach ("गुरु हो तो नासिकाव्रण, शुक्र हो तो नेत्रव्रण, शनि हो तो पादव्रण और राहु केतु हो तो उदरव्रण") -- a scheme that differs slightly from this verse's own wording (which pairs Moon with Rahu for कुक्षि/flank rather than assigning Saturn to the foot); both readings are disclosed here rather than silently reconciled. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नाधिपः कुज-क्षेत्रे बुधक्षेत्रेऽपि वा स्थिते । यत्र कुत्र स्थितो ज्ञेन वीक्षितो मुखरुक्प्रदः ॥ ६ ॥

lagnaadhipah kuja-kshetre budhakshetreapi vaa sthite | yatra kutra sthito jnena veekshito mukharukprada || 6 ||

अंग्रेज़ी अर्थ

[If] the lord of the ascendant (lagna-adhipah) is situated in the sign/field of Mars (kuja-kshetre sthite) or (vaa api) of Mercury (budha-kshetre), wherever situated (yatra kutra sthitah), [and] is aspected by Mercury (jnena veekshitah), it causes affliction to the face (mukha-ruk-pradah).

हिन्दी अर्थ

[यदि] लग्नेश (लग्नाधिपः) मंगल के क्षेत्र (कुज-क्षेत्रे) या (वा अपि) बुध के क्षेत्र में स्थित हो (बुधक्षेत्रेऽपि स्थिते), जहाँ कहीं भी स्थित हो (यत्र कुत्र स्थितो), और बुध से दृष्ट हो (ज्ञेन वीक्षितो), तो मुख-रोग/पीड़ा देने वाला होता है (मुखरुक्प्रदः)।

स्रोत: BPHS Ch.18, verse 6. PDF p.129, printed page ९८. Confirmed via scratchpad/p129-v5-6.png. This closes the page's Hindi commentary block marked "॥ १-६ ॥" (confirmed via scratchpad/p129-v7-8.png), excluded from transcription per copyright-safety discipline. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नाधिपौ कुजबुधौ चन्द्रेण सहितौ यदि । राहुणा शनिना सार्धं, कुष्ठं तत्र विनिर्दिशेत् ॥ ७ ॥

lagnaadhipau kujabudhau chandrena sahitau yadi | raahunaa shaninaa saardham, kushtham tatra vinirdishet || 7 ||

अंग्रेज़ी अर्थ

If (yadi) the lord of the ascendant, Mars and Mercury (lagna-adhipau kuja-budhau) are joined with the Moon (chandrena sahitau), together with Rahu and Saturn (raahunaa shaninaa saardham), leprosy (kushtham) should be predicted therein (tatra vinirdishet).

हिन्दी अर्थ

यदि (यदि) लग्नेश, मंगल और बुध (लग्नाधिपौ कुजबुधौ) चन्द्रमा से युक्त हों (चन्द्रेण सहितौ), राहु और शनि के साथ (राहुणा शनिना साधं), तो वहाँ कुष्ठ (कुष्ठं) रोग बताना चाहिए (तत्र विनिर्दिशेत्)।

स्रोत: BPHS Ch.18, verse 7, opening a new sub-heading "कुछ योग" (a few combinations) marked in the page's Hindi text (editorial framing, excluded from transcription). PDF p.129, printed page ९८. Confirmed via scratchpad/p129-v7-8b.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नाधिपं विना लग्ने स्थितश्चेत्तमसा शशी । श्वेतकुष्ठं तदा कृष्णकुष्ठं च शनिना सह ॥ ८ ॥ कुजेन रक्तकुष्ठं स्यात्तत्तदेवं विचारयेत् ।

lagnaadhipam vinaa lagne sthitashchettamasaa shashee | shvetakushtham tadaa krishnakushtham cha shaninaa saha || 8 || kujena raktakushtham syaattattadevam vichaarayet |

अंग्रेज़ी अर्थ

[If] the Moon (shashee), without the lord of the ascendant (lagna-adhipam vinaa), is situated in the ascendant (lagne sthitah) and [afflicted] by darkness [Rahu/Ketu] (tamasaa), then white leprosy (shveta-kushtham tadaa) [occurs]; and with Saturn (shaninaa saha), black leprosy (krishna-kushtham cha). [Unnumbered coda:] With Mars, it would be red-colored leprosy (kujena rakta-kushtham syaat); one should consider each such case similarly (tat tad evam vichaarayet).

हिन्दी अर्थ

[यदि] चन्द्रमा (शशी), लग्नेश के बिना (लग्नाधिपं विना), लग्न में स्थित हो (लग्ने स्थितश्चेत्) और तम [राहु/केतु] से युक्त हो (तमसा), तो श्वेत कुष्ठ (श्वेतकुष्ठं तदा) होता है; और शनि के साथ हो (शनिना सह) तो कृष्ण कुष्ठ (कृष्णकुष्ठं च) होता है। [अक्रमांकित पूरक पंक्ति:] मंगल से रक्तवर्ण कुष्ठ होता है (कुजेन रक्तकुष्ठं स्यात्), इसी प्रकार अन्य सभी स्थितियों पर विचार करना चाहिए (तत्तदेवं विचारयेत्)।

स्रोत: BPHS Ch.18, verse 8, plus an unnumbered catch-all coda line immediately following it on the same page (PDF p.129, printed page ९८). Confirmed via scratchpad/p129-v8-9.png, scratchpad/p129-v9-end.png and scratchpad/p129-v9-fullline2.png: the coda line "कुजेन रक्तकुष्ठं स्यात्तत्तदेवं विचारयेत् ।" ends with only a single danda and no trailing verse-number, with blank space to its right, confirming it genuinely carries no verse number in print (unlike every other verse on this page). It functions as an editorial "consider similarly for other planets/cases" catch-all remark closing the कुष्ठ (leprosy-color) topic opened at verse 7. This is NOT the opening of verse 9: the genuinely-numbered verse 9 ("लग्ने षष्ठाष्टमाधीशौ रविणा चेत् समन्वितौ ॥ ९ ॥", see ref 18.9) appears on the following page (PDF p.130) under an entirely new heading "गण्डादि रोग योग—" (combinations for glandular swelling/disease), addressing a different topic (6th/8th lords with the Sun) rather than continuing the leprosy-color diagnosis. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

गण्डादि रोग योग— लग्ने पष्ठाष्टमाधीशौ रविणा चेत् समन्वितौ ॥ ९ ॥

gandaadi roga yoga-- lagne pashthaashtamaadheeshau ravinaa chet samanvitau || 9 ||

अंग्रेज़ी अर्थ

[Combinations for glandular swelling and other diseases--] [If], in the ascendant (lagne), the lords of the 6th and 8th (shashtha-ashtama-adheeshau) are joined with the Sun (ravinaa chet samanvitau) [disease/swelling results, as detailed in the following verses].

हिन्दी अर्थ

[गण्डादि रोग योग--] [यदि] लग्न में (लग्ने) षष्ठ और अष्टम भाव के स्वामी (षष्ठाष्टमाधीशौ) सूर्य से युक्त हों (रविणा चेत् समन्वितौ), [तो रोग/गण्ड होता है, जैसा आगे के श्लोकों में बताया गया है]।

स्रोत: BPHS Ch.18, verse 9, opening a new sub-heading "गण्डादि रोग योग" (combinations for glandular swelling and other diseases). PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v9-10.png. This is a single-line verse (unlike the surrounding two-line verses), and is a genuinely fresh, differently-numbered verse distinct from the unnumbered coda following verse 8 on the previous page (see the disclosure at ref 18.8). English/Hindi meanings by Vedic Hora -- for review. CORRECTION/DISCLOSURE: the printed text reads "पष्ठाष्टमाधीशौ" (with प, not ष) as its very first letter -- confirmed via extreme zoom (scratchpad/p130-v9-word-zoom2.png), and confirmed as a genuine, isolated print variant rather than a general font quirk by comparing against verse 15's "षष्ठे" on the same page (scratchpad/p130-v15-pashtha-check.png), which prints a clearly normal ष in the same position. Retained as printed (पष्ठाष्टमाधीशौ) in sanskrit/iast; translation/translationHi use the contextually-intended standard reading "षष्ठाष्टमाधीशौ" (lords of the 6th and 8th houses), which matches this verse's own subject (6th/8th-lord combinations with the Sun) and the surrounding verses' consistent 6th/8th-house theme.

संस्कृत

ज्वरगण्डः कुजे ग्रन्थिः शस्त्रव्रणमथापि वा । बुधेन पित्तं गुरुणा रोगाभावं विनिर्दिशेत् ॥ १० ॥

jvaragandah kuje granthih shastravranamathaapi vaa | budhena pittam gurunaa rogaabhaavam vinirdishet || 10 ||

अंग्रेज़ी अर्थ

[If] with Mars (kuje), fever-swelling (jvara-gandah), a cyst/knot (granthih), or else a wound from a weapon (shastra-vranam athaapi vaa); with Mercury (budhena) biliousness (pittam); with Jupiter (gurunaa) one should predict the absence of disease (rogaabhaavam vinirdishet).

हिन्दी अर्थ

[यदि] मंगल से (कुजे) ज्वर-गण्ड (ज्वरगण्डः), गाँठ (ग्रन्थिः), अथवा शस्त्र से घाव (शस्त्रव्रणमथापि वा); बुध से (बुधेन) पित्त-रोग (पित्तं); गुरु से (गुरुणा) रोगाभाव कहना चाहिए (रोगाभावं विनिर्दिशेत्)।

स्रोत: BPHS Ch.18, verse 10. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v9-10.png (line 1) and scratchpad/p130-v11-12.png (line 2, top edge). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

स्त्रीभिः शुक्रेण शनिना वायुना संयुतो यदि । गण्डश्चाण्डालतो नाभौ केतुना तु गृहे भयम् ॥ ११ ॥

streebhih shukrena shaninaa vaayunaa sanyuto yadi | gandashchaandaalato naabhau ketunaa tu grihe bhayam || 11 ||

अंग्रेज़ी अर्थ

With Venus (shukrena), [disease] through women (streebhih); if joined with Saturn (shaninaa), affliction by wind/vaata (vaayunaa sanyuto yadi); with Ketu (ketunaa), swelling in the navel caused by an outcaste (gandah chaandaalatah naabhau), and fear at home (grihe bhayam).

हिन्दी अर्थ

शुक्र से (शुक्रेण) स्त्रियों के कारण रोग (स्त्रीभिः); यदि शनि से युक्त हो (शनिना संयुतो यदि) तो वायु-प्रकोप (वायुना); केतु से (केतुना) नाभि में चाण्डाल-कृत गण्ड (गण्डश्चाण्डालतो नाभौ), और घर में भय (गृहे भयम्)।

स्रोत: BPHS Ch.18, verse 11. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v11-12.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चन्द्रेण गण्डः सलिलैः कफश्लेष्मादिना भवेत् । एवं पित्रादि-भावान्तं तत्तत्कारकयोगतः ॥ १२ ॥ गण्डस्तेषां भवेदेव-मूढ्यमेतन्मनीषिभिः ।

chandrena gandah salilaih kaphashleshmaadinaa bhavet | evam pitraadi-bhaavaantam tattatkaarakayogatah || 12 || gandasteshaam bhavedeva-moodhyametanmaneeshibhih || 12.5 ||

अंग्रेज़ी अर्थ

With the Moon (chandrena), swelling occurs from water (salilaih), phlegm/kapha and the like (kapha-shleshma-aadinaa bhavet). In this same manner, [the diagnosis extends] through all houses beginning from the father's [9th house] onward (evam pitraadi-bhaava-antam), according to the combination of each house's respective significator (tat tat kaaraka-yogatah). [Unnumbered coda:] Swelling [judged] for these [various houses/significators] indeed occurs (gandah teshaam bhavet eva); this [subject] should be regarded [with due caution/difficulty] by the wise (moodhyam etat maneeshibhih).

हिन्दी अर्थ

चन्द्रमा से (चन्द्रेण) जल से (सलिलैः), कफ-श्लेष्मादि से (कफश्लेष्मादिना) गण्ड (सूजन) होता है (गण्डः भवेत्)। इसी प्रकार पितृ आदि (नवमादि) भावों तक (पित्रादि-भावान्तं) उन-उन कारकों के योग से विचार करें (तत्तत्कारकयोगतः)। [अक्रमांकित पूरक पंक्ति:] इन सबका गण्ड इसी प्रकार होता है (गण्डस्तेषां भवेदेव), यह विषय बुद्धिमानों के लिए भी दुरूह (कठिन) है (मूढ्यमेतन्मनीषिभिः)।

स्रोत: BPHS Ch.18, verse 12, closing the "गण्डादि रोग योग" sub-section (verses 9-12), plus an unnumbered half-verse coda immediately following it in print. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v11-12.png (verse 12 line 1) and scratchpad/p130-v12-coda.png (verse 12 line 2 with its "॥ १२ ॥" marker, and the coda line "गण्डस्तेषां भवेदेव-मूढ्यमेतन्मनीषिभिः ।" ending in a single danda with no verse number of its own). The coda's status as a legitimate, editor-acknowledged half-verse (rather than a stray fragment) is independently confirmed by the Hindi commentary block that follows it on the same page, which explicitly closes with the range marker "॥ ९-१२½ ॥" (confirmed via scratchpad/p130-marker.png) -- proving the editor himself counts this coda as "verse 12½" of this sub-section. The coda's own wording ("मूढ्यम्", roughly "a matter of confusion/difficulty") is itself a caveat about the difficulty of this diagnostic topic, consistent with treating it as the sub-section's closing remark rather than fabricating a forced resolution. A new heading "रोगाधिसमय--" (time of disease onset) begins immediately after, on the same page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रोगाधिसमय— रोगस्थानगते पापे तदीशे पापसंयुते ॥ १३ ॥

rogaadhisamaya-- rogasthaanagate paape tadeeshe paapasanyute || 13 ||

अंग्रेज़ी अर्थ

[On the timing of disease onset--] [If] a malefic (paape) is situated in the disease-house [6th house] (roga-sthaana-gate), and its lord (tad-ishe) is joined with a malefic (paapa-sanyute), [the specific results follow according to the exact combination, as detailed in the succeeding verses].

हिन्दी अर्थ

[रोग होने के समय के विषय में--] [यदि] रोग-स्थान (षष्ठ भाव) में पाप ग्रह हो (रोगस्थानगते पापे), और उसका स्वामी (तदीशे) पाप ग्रह से युक्त हो (पापसंयुते), [तो ठीक-ठीक फल आगे के श्लोकों में वर्णित संयोग के अनुसार होता है]।

स्रोत: BPHS Ch.18, verse 13, opening a new sub-heading "रोगाधिसमय" (the timing of disease onset). PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v13-14.png. This is a single-line verse (as with verse 9), stating a general condition whose specific results (by planet and year) are given across the following verses -- the condition/result pattern interleaves across verse-numbered boundaries throughout this sub-section (verse 13's condition is resolved in verse 14's first line; verse 14's second-line condition is resolved in verse 15's first line; and so on through verse 18), consistent with this text's characteristically telegraphic style already seen at ref 18.3. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

राहुणा संयुते मन्दे सर्वदा रोगसंयुतः । रोगस्थानगते भौमे तदीशे रन्ध्रसंयुते ॥ १४ ॥

raahunaa sanyute mande sarvadaa rogasanyutah | rogasthaanagate bhaume tadeeshe randhrasanyute || 14 ||

अंग्रेज़ी अर्थ

[Continuing from verse 13:] [If that malefic is] Saturn (mande) joined with Rahu (raahunaa sanyute), [the native] is always afflicted with disease (sarvadaa roga-sanyutah). [Alternatively, if] Mars (bhaume) is situated in the disease-house (roga-sthaana-gate) [and] its lord (tad-ishe) is joined with the 8th house (randhra-sanyute), [disease likewise results, timed as given in the next verse].

हिन्दी अर्थ

[श्लोक १३ से आगे:] [यदि वह पाप ग्रह] शनि (मन्दे) राहु से युक्त हो (राहुणा संयुते), तो सदैव रोग-युक्त रहता है (सर्वदा रोगसंयुतः)। [अथवा यदि] मंगल (भौमे) रोग-स्थान में स्थित हो (रोगस्थानगते), [और] उसका स्वामी (तदीशे) अष्टम भाव से युक्त हो (रन्ध्रसंयुते), [तो भी रोग होता है, जिसका समय अगले श्लोक में बताया गया है]।

स्रोत: BPHS Ch.18, verse 14. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v13-14.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षष्ठे वा द्वादशे वर्षे ज्वररोगी भवेन्नरः । पष्ठस्थानगते जीवे तद्गृहे चन्द्रसंयुते ॥ १५ ॥

shashthe vaa dvaadashe varshe jvararogee bhavennarah | pashthasthaanagate jeeve tadgrihe chandrasanyute || 15 ||

अंग्रेज़ी अर्थ

[As the result of verse 14's Mars combination:] the person becomes afflicted with fever-disease (jvara-rogee bhavet narah) in the 6th or the 12th year (shashthe vaa dvaadashe varshe). [Alternatively, if] Jupiter (jeeve) is situated in the 6th house (shashtha-sthaana-gate) [and] the Moon (chandra-sanyute) is joined in its [Jupiter's] own sign (tad-grihe), [a further result is given in the next verse].

हिन्दी अर्थ

[श्लोक १४ के मंगल-योग के फलस्वरूप] मनुष्य छठे या बारहवें वर्ष में ज्वर-रोगी होता है (षष्ठे वा द्वादशे वर्षे ज्वररोगी भवेन्नरः)। [अथवा यदि] गुरु (जीवे) षष्ठ भाव में स्थित हो (षष्ठस्थानगते), [और] उसके अपने घर में चन्द्रमा युक्त हो (तद्गृहे चन्द्रसंयुते), [तो आगे का फल अगले श्लोक में है]।

स्रोत: BPHS Ch.18, verse 15. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v15-16.png. Second line's opening word prints "पष्ठस्थानगते" (with प) rather than the expected "षष्ठस्थानगते" (ष) -- confirmed via extreme zoom (scratchpad/p130-v15L2-check.png) as a print variant of the same kind disclosed at ref 18.9, and confirmed NOT to be a general font rendering of ष (this same page's first line here prints a normal, clearly distinct ष in "षष्ठे", see scratchpad/p130-v15-pashtha-check.png). Retained as printed in sanskrit/iast; translation/translationHi use the contextually-intended standard reading "षष्ठस्थानगते" (situated in the 6th house), consistent with this sub-section's disease-house (6th-house) theme. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्वाविंशकोनविंशेऽब्दे कुष्ठरोगं विनिर्दिशेत् । रोगस्थानं गते राहौ केन्द्रे मान्दिससमन्विते ॥ १६ ॥

dvaavinshakonavinshe.abde kushtharogam vinirdishet | rogasthaanam gate raahau kendre maandisasamanvite || 16 ||

अंग्रेज़ी अर्थ

[As the result of verse 15's Jupiter-Moon combination:] one should predict leprosy-disease (kushtha-rogam vinirdishet) in the 22nd or the 19th year (dvaavinsha-konavinshe abde). [Alternatively, if] Rahu (raahau) is situated in the disease-house [6th] (roga-sthaanam gate), [with] a kendra [angular house] joined with Maandi/Gulika (kendre maandisa-manvite), [a further result is given in the next verse].

हिन्दी अर्थ

[श्लोक १५ के गुरु-चन्द्र योग के फलस्वरूप] बाईसवें या उन्नीसवें वर्ष में कुष्ठ-रोग कहना चाहिए (द्वाविंशकोनविंशेऽब्दे कुष्ठरोगं विनिर्दिशेत्)। [अथवा यदि] राहु (राहौ) रोग-स्थान (षष्ठ भाव) में स्थित हो (रोगस्थानं गते), [और] कोई केन्द्र मान्दि (गुलिक) से युक्त हो (केन्द्रे मान्दिससमन्विते), [तो आगे का फल अगले श्लोक में है]।

स्रोत: BPHS Ch.18, verse 16. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v15-16.png (line 1, top edge) and scratchpad/p130-v17-18.png (line 2, top edge). "मान्दि" (Maandi/Gulika) is a calculated upagraha (sub-planet) distinct from Saturn ("मन्द", used at verse 14); the precise syntactic linkage between "राहौ" and "केन्द्रे मान्दिससमन्विते" is left in this text's characteristically compressed/telegraphic form, as with other terse combination-verses in this chapter. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नेशे नाशराशिस्थे षड्विंशे क्षयरोगिता । व्ययेशे रोगराशिस्थे तदीशे व्ययराशिगे ॥ १७ ॥

lagneshe naasharaashisthe shadvinshe kshayarogitaa | vyayeshe rogaraashisthe tadeeshe vyayaraashige || 17 ||

अंग्रेज़ी अर्थ

[As the result of verse 16's Rahu-Maandi combination:] when the lord of the ascendant (lagna-ishe) is situated in an adverse/"destruction" sign (naasha-raashi-sthe), there is wasting-disease in the 26th year (shad-vinshe kshaya-rogitaa). [Alternatively, if] the lord of the 12th (vyaya-ishe) is situated in the disease-sign [6th sign] (roga-raashi-sthe), [and] its [the 6th sign's] lord (tad-ishe) is situated in the 12th sign (vyaya-raashi-ge), [a further result is given in the next verse].

हिन्दी अर्थ

[श्लोक १६ के राहु-मान्दि योग के फलस्वरूप] जब लग्नेश (लग्नेशे) नाश-राशि (अशुभ राशि) में स्थित हो (नाशराशिस्थे), तो छब्बीसवें वर्ष में क्षय-रोग होता है (षड्विंशे क्षयरोगिता)। [अथवा यदि] व्ययेश (व्ययेशे) रोग-राशि (षष्ठ राशि) में स्थित हो (रोगराशिस्थे), [और] उसका स्वामी (तदीशे) व्यय-राशि (द्वादश राशि) में स्थित हो (व्ययराशिगे), [तो आगे का फल अगले श्लोक में है]।

स्रोत: BPHS Ch.18, verse 17. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v17-18.png. "नाशराशि" ("destruction sign") is retained as printed; it is understood contextually as an adverse/inimical sign for the ascendant lord, without a more specific technical gloss available from the surrounding page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

ऊनत्रिंशेऽथवा त्रिंशे वर्षे गुल्मरुजं दिशेत् । रिपुस्थानगते चन्द्रे शनिना संयुते सति ॥ १८ ॥

oonatrinshe.athavaa trinshe varshe gulmarujam dishet | ripusthaanagate chandre shaninaa sanyute sati || 18 ||

अंग्रेज़ी अर्थ

[As the result of verse 17's combination:] one should predict gulma-disease [a glandular/abdominal swelling-type ailment] (gulma-rujam dishet) in the 29th or the 30th year (oona-trinshe athavaa trinshe varshe). [Alternatively, if] the Moon (chandre) is situated in the 6th house [the "enemy-house"] (ripu-sthaana-gate), joined with Saturn (shaninaa sanyute sati), [the result continues on the following page].

हिन्दी अर्थ

[श्लोक १७ के योग के फलस्वरूप] उनतीसवें या तीसवें वर्ष में गुल्म-रोग (उदर-सम्बन्धी सूजन/ग्रन्थि रोग) कहना चाहिए (ऊनत्रिंशेऽथवा त्रिंशे वर्षे गुल्मरुजं दिशेत्)। [अथवा यदि] चन्द्रमा (चन्द्रे) रिपु-स्थान (षष्ठ भाव) में स्थित हो (रिपुस्थानगते), शनि से युक्त हो (शनिना संयुते सति), [तो फल अगले पृष्ठ पर जारी रहता है]।

स्रोत: BPHS Ch.18, verse 18, the last verse on this page. PDF p.130, printed page ९९. Confirmed via scratchpad/p130-v17-18.png and scratchpad/bphs-p130-overview.png (confirming the page ends immediately after this verse, with no trailing Hindi commentary block visible -- the Moon-Saturn condition's result and any commentary on this sub-section continue onto the next page, PDF p.131). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पञ्चपञ्चाशदब्देषु लग्नेशे लशराशिस्थे मन्दे शत्रुसमन्विते ॥ १९ ॥

panchapanchaashadabdeshu lagneshe lasharaashisthe mande shatrusamanvite || 19 ||

अंग्रेज़ी अर्थ

In the fifty-fifth year (pancha-panchaashad-abdeshu), [if] the lord of the ascendant (lagneshe) is situated [in a weak/hostile sign] (-raashisthe), [and] joined with Saturn (mande) [who is himself] with an enemy [i.e. in an inimical sign] (shatru-samanvite) [wind-disease/vaata-roga results].

हिन्दी अर्थ

पचपनवें वर्ष में (पञ्चपञ्चाशदब्देषु) यदि लग्नेश (लग्नेशे) [दुर्बल/शत्रु] राशि में स्थित हो (-राशिस्थे), और शनि से युक्त हो (मन्दे), जो स्वयं शत्रु-राशि में हो (शत्रुसमन्विते), [तो वातरोग होता है]।

स्रोत: BPHS Ch.18, verse 19, opening a new pair of verses on PDF p.131 (printed page १००), immediately following the page-130/131 boundary after verse 18. Confirmed via scratchpad/p131-v19-20.png (full verse), scratchpad/p131-v19-line1.png (extreme zoom on the opening numeral phrase), and scratchpad/p131-v19-line2.png plus scratchpad/p131-v19-line2b.png (extreme zoom on the second half). DISCLOSURE 1 (numeral phrase): the printed glyphs for the opening word read closer to "पश्वपश्वाशदब्देषु" at this zoom level -- the conjunct after the initial प renders ambiguously between ञ्च and श्व/श्च in this edition's typeface (a ligature-rendering ambiguity noted before in this text). The contextually near-certain intended reading, consistent with this chapter's running theme of specific life-year age markers (cf. verses 15, 16, 18 all naming specific years) and yielding a sensible "fifty-fifth year" (pancha-panchaashat), is "पञ्चपञ्चाशदब्देषु"; this is what is used in translation/translationHi, while sanskrit/iast retain this standard reading here as the print does not clearly support any alternative numeral. DISCLOSURE 2 (लश vs लग्न): the word immediately following लग्नेशे is genuinely printed "लशराशिस्थे" (ल-श-रा-शि-स्थे), clearly distinct in print from "लग्न" earlier in the same compound-adjacent word -- confirmed via scratchpad/p131-v19-line2.png, a wide/clear crop showing ल followed distinctly by श (not ग्न). This is retained as printed (लशराशिस्थे) in sanskrit/iast, exactly as printed, without forcing the contextually-plausible "लग्नराशिस्थे" (in the ascendant's own sign) or any other resolution -- the meaning of ल-श in this position is left to the reader/future review. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

एकोनषष्टिवर्षे तु वातरोगादितो भवेत् । रन्ध्रेशे रिपुराशिस्थे व्ययेशे लग्नसंस्थिते ॥ २० ॥

ekonashashtivarshe tu vaatarogaadito bhavet | randhreshe ripuraashisthe vyayeshe lagnasansthite || 20 ||

अंग्रेज़ी अर्थ

In the fifty-ninth year (ekona-shashti-varshe), indeed (tu), wind-disease and the like would occur (vaata-roga-aditah bhavet), [if] the lord of the 8th (randhreshe) is situated in an inimical sign (ripu-raashisthe), [and] the lord of the 12th (vyayeshe) is situated in the ascendant (lagna-sansthite).

हिन्दी अर्थ

उनसठवें वर्ष में (एकोनषष्टिवर्षे) निश्चय ही (तु) वातरोग आदि होता है (वातरोगादितो भवेत्), यदि अष्टमेश (रन्ध्रेशे) शत्रु राशि में स्थित हो (रिपुराशिस्थे), और द्वादशेश (व्ययेशे) लग्न में स्थित हो (लग्नसंस्थिते)।

स्रोत: BPHS Ch.18, verse 20. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v20.png. This word ("षष्टि", 59th) prints its ष normally, unlike the recurring प/ष substitution seen elsewhere in this and the surrounding pages' "षष्ठ"-compounds (see refs 18.9, 18.15) -- confirming again that the substitution is specific to certain षष्ठ-compounds and not a general font rendering of ष. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

चन्द्रे पष्ठेशसंयुक्ते वसुवर्षे मृगाङ्कयम् । पष्ठाष्टम-गतो राहुस्तस्मादष्टमगे शनौ ॥ २१ ॥

chandre pashtheshasanyukte vasuvarshe mrigaankayam | pashthaashtama-gato raahustasmaadashtamage shanau || 21 ||

अंग्रेज़ी अर्थ

With the Moon (chandre) joined with the lord of the 6th (shashthesha-sanyukte -- printed पष्ठेश), in the eighth year (vasu-varshe) [something afflicts] the Moon-related [significations] (mrigaankayam); [if] Rahu is placed in the 6th-8th [axis] (shashtha-ashtama-gatah raahuh -- printed पष्ठाष्टम), Saturn being in the 8th from that (tasmaad ashtamage shanau).

हिन्दी अर्थ

चन्द्रमा (चन्द्रे) षष्ठेश से युक्त हो (पष्ठेशसंयुक्ते), आठवें वर्ष में (वसुवर्षे) चन्द्र-सम्बन्धी [कष्ट होता है] (मृगाङ्कयम्); यदि राहु षष्ठाष्टम में स्थित हो (पष्ठाष्टम-गतो राहु), और उससे अष्टम में शनि हो (तस्मादष्टमगे शनौ)।

स्रोत: BPHS Ch.18, verse 21. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v21.png. DISCLOSURE (प/ष pattern, continuing): both "षष्ठेश" and "षष्ठाष्टम" print with प in place of the first ष ("पष्ठेश", "पष्ठाष्टम"), consistent with the recurring typesetting substitution already established at refs 18.9 and 18.15. Retained as printed in sanskrit/iast; translation/translationHi use the standard षष्ठ reading. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

प्रथमे वा द्वितीयेऽब्दे जातकस्य द्विजोत्तम । भवेदग्निभयं तस्य त्रिवर्षे पक्षिदोषभाक् ॥ २२ ॥

prathame vaa dviteeye.abde jaatakasya dvijottama | bhavedagnibhayam tasya trivarshe pakshidoshabhaak || 22 ||

अंग्रेज़ी अर्थ

In the first (prathame) or (vaa) second year (dviteeye abde) of the native (jaatakasya), O best of the twice-born (dvijottama), fire-fear (agni-bhayam) would befall him (bhavet tasya); in the third year (tri-varshe) [he would be] possessed of a bird-related fault/affliction (pakshi-dosha-bhaak).

हिन्दी अर्थ

जातक के प्रथम (प्रथमे) या (वा) द्वितीय वर्ष में (द्वितीयेऽब्दे), हे द्विजोत्तम (द्विजोत्तम), उसे अग्नि-भय होता है (भवेदग्निभयं तस्य); तृतीय वर्ष में (त्रिवर्षे) पक्षी-सम्बन्धी दोष होता है (पक्षिदोषभाक्)।

स्रोत: BPHS Ch.18, verse 22. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v22.png. This verse addresses the very-early-childhood years (1st-3rd), a change of topic/timeframe from the surrounding verses; the address "द्विजोत्तम" (O best of the twice-born) is the text's standing address to the listener-sage, consistent with usage elsewhere in BPHS. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

पष्ठाष्टमगते सूर्ये तद्व्यये चन्द्रसंयुते । पश्चमे नवमेऽब्दे तु जलभीतिं विनिर्दिशेत् ॥ २३ ॥

pashthaashtamagate soorye tadvyaye chandrasanyute | panchame navame.abde tu jalabheetim vinirdishet || 23 ||

अंग्रेज़ी अर्थ

[If] the Sun (soorye) is situated in the 6th-8th [axis] (shashtha-ashtama-gate -- printed पष्ठाष्टम), [and] the 12th from that (tad-vyaye) is joined with the Moon (chandra-sanyute), then in the fifth (panchame) or ninth year (navame abde), indeed (tu), one should predict fear from water (jala-bheetim vinirdishet).

हिन्दी अर्थ

यदि सूर्य षष्ठाष्टम में स्थित हो (पष्ठाष्टमगते सूर्ये), और उससे द्वादश भाव चन्द्रमा से युक्त हो (तद्व्यये चन्द्रसंयुते), तो पंचम (पश्चमे) अथवा नवम वर्ष में (नवमेऽब्दे) जल-भय कहना चाहिए (जलभीतिं विनिर्दिशेत्)।

स्रोत: BPHS Ch.18, verse 23. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v23.png. DISCLOSURE 1 (प/ष pattern, continuing): "षष्ठाष्टम" again prints with प ("पष्ठाष्टम"), consistent with refs 18.9, 18.15, 18.21. DISCLOSURE 2 (ञ्च/श्च ligature ambiguity, continuing): the word for "fifth" prints as "पश्चमे", with the same conjunct-rendering ambiguity already flagged at ref 18.19 between ञ्च and श्च in this edition's type -- the contextually certain intended reading is "पञ्चमे" (fifth), which is used in translation/translationHi; sanskrit/iast retain the standard पञ्चमे reading here since, unlike ref 18.19's longer compound, no plausible alternate reading of this short, common word exists. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अष्टमे मन्दसंयुक्ते रन्ध्राद्वा द्वादशे कुजः । दशमेऽब्देऽथवा त्रिंशे स्फोटकादि विनिर्दिशेत् ॥ २४ ॥

ashtame mandasanyukte randhraadvaa dvaadashe kujah | dashame.abde.athavaa trinshe sphotakaadi vinirdishet || 24 ||

अंग्रेज़ी अर्थ

[If] Mars (kujah) [is] in the 8th (ashtame) joined with Saturn (manda-sanyukte), or (vaa) from the 8th [placed] in the 12th (randhraat dvaadashe), then in the tenth (dashame abde) or (athavaa) thirtieth year (trinshe), one should predict smallpox/pustular disease and the like (sphotaka-aadi vinirdishet).

हिन्दी अर्थ

यदि मंगल (कुजः) अष्टम में (अष्टमे) शनि से युक्त हो (मन्दसंयुक्ते), अथवा अष्टम से द्वादश में हो (रन्ध्राद्वा द्वादशे), तो दशम (दशमेऽब्दे) अथवा त्रिंशत्तम वर्ष में (अथवा त्रिंशे) चेचक/स्फोटक आदि रोग कहना चाहिए (स्फोटकादि विनिर्दिशेत्)।

स्रोत: BPHS Ch.18, verse 24. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v24.png. DISCLOSURE (possible म/भ typesetting variant, new/tentative): the word for "tenth" appears to print as "दशभे" rather than the expected "दशमे" at this zoom level -- given the already-established pattern of consonant-substitution variants in this edition (व/ब in colophons, प/ष in षष्ठ-compounds), this may be a further instance (भ for म) rather than a misreading, but has not been cross-checked against a second, unambiguous same-page instance of either letter the way the प/ष pattern was confirmed at ref 18.9/18.15. Sanskrit/iast use the standard, contextually-certain "दशमे" (tenth) reading pending a clearer zoom crop; flagged here for future re-verification rather than silently assumed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

रन्ध्रेशे राहुसंयुक्ते तदंशे रन्ध्रकोणगे । द्वाविंशेऽष्टादशे वर्षे ग्रन्थि-मेहादि-पीडनम् ॥ २५ ॥

randhreshe raahusanyukte tadanshe randhrakonage | dvaavinshe.ashtaadashe varshe granthi-mehaadi-peedanam || 25 ||

अंग्रेज़ी अर्थ

[If] the lord of the 8th (randhreshe) is joined with Rahu (raahu-sanyukte), [and] its portion/placement (tad-anshe) is in a trine to the 8th (randhra-konage), then in the twenty-second (dvaavinshe) or eighteenth year (ashtaadashe varshe), affliction by cysts, urinary disease and the like occurs (granthi-meha-aadi-peedanam).

हिन्दी अर्थ

यदि अष्टमेश (रन्ध्रेशे) राहु से युक्त हो (राहुसंयुक्ते), और उसका अंश अष्टम के त्रिकोण में हो (तदंशे रन्ध्रकोणगे), तो बाईसवें (द्वाविंशे) अथवा अठारहवें वर्ष में (अष्टादशे वर्षे) गाँठ, प्रमेह आदि रोग से पीड़ा होती है (ग्रन्थि-मेहादि-पीडनम्)।

स्रोत: BPHS Ch.18, verse 25. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v25.png. The word "तदंशे" (its portion/degree) is transcribed as printed; an alternative reading such as "तदीशे" (its lord) is contextually plausible given the pattern of neighboring verses referring to a house's lord, but is not what is clearly printed, so the literal reading is retained without forcing the alternative. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लाभेशे रिपुभावस्थे तदीशे लाभराशिगे । एकत्रिंशे भवेदब्दे शत्रुमूलाद्धनव्ययः ॥ २६ ॥

laabheshe ripubhaavasthe tadeeshe laabharaashige | ekatrinshe bhavedabde shatrumoolaaddhanavyayah || 26 ||

अंग्रेज़ी अर्थ

[If] the lord of the 11th (laabheshe) is situated in an inimical house (ripu-bhaavasthe), [and] its lord (tadeeshe) is placed in the 11th sign (laabha-raashige), then in the thirty-first year (ekatrinshe bhavet abde), loss of wealth arises from an enemy's root/cause (shatru-moolaat dhana-vyayah).

हिन्दी अर्थ

यदि लाभेश (लाभेशे) शत्रु भाव में स्थित हो (रिपुभावस्थे), और उसका स्वामी लाभ राशि में हो (तदीशे लाभराशिगे), तो इकतीसवें वर्ष में (एकत्रिंशे भवेदब्दे) शत्रु के कारण धन-हानि होती है (शत्रुमूलाद्धनव्ययः)।

स्रोत: BPHS Ch.18, verse 26. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v26.png. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सुतेशे रिपुभावस्थे षष्ठेशे गुरुसंयुते । व्ययेशे लग्नभावस्थे तस्य पुत्रो रिपुर्भवेत् ॥ २७ ॥

suteshe ripubhaavasthe shashtheshe gurusanyute | vyayeshe lagnabhaavasthe tasya putro ripurbhavet || 27 ||

अंग्रेज़ी अर्थ

[If] the lord of the 5th (suteshe) is situated in an inimical house (ripu-bhaavasthe), [and] the lord of the 6th (shashtheshe) is joined with Jupiter (guru-sanyute), [and] the lord of the 12th (vyayeshe) is situated in the ascendant-house (lagna-bhaavasthe), his (the native's) son becomes an enemy (tasya putrah ripuh bhavet).

हिन्दी अर्थ

यदि पुत्रेश (सुतेशे) शत्रु भाव में स्थित हो (रिपुभावस्थे), षष्ठेश (षष्ठेशे) गुरु से युक्त हो (गुरुसंयुते), और द्वादशेश (व्ययेशे) लग्न भाव में स्थित हो (लग्नभावस्थे), तो उसका पुत्र शत्रु होता है (तस्य पुत्रो रिपुर्भवेत्)।

स्रोत: BPHS Ch.18, verse 27. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v27.png. Here "षष्ठेशे" prints with a normal ष (not the प variant seen elsewhere), providing a further same-page cross-check -- alongside ref 18.20's "षष्टि" -- that the प/ष substitution established at refs 18.9, 18.15, 18.21, 18.23 is a specific, recurring-but-inconsistent typesetting variant rather than a uniform font characteristic, and is not present in every षष्ठ-occurrence on this page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नेशे पष्ठराशिस्थे पष्ठेशोऽपि च पष्ठगे । दशमैकोनविंशेऽब्दे शुनकाद् भीतिरुच्यते ॥ २८ ॥ इति सविमर्श-सुधाव्याख्योपेते बृहत्पाराशरहोराशास्त्रे पष्ठभावफलाध्यायः ॥ १८ ॥

lagneshe pashtharaashisthe pashthesho.api cha pashthage | dashamaikonavinshe.abde shunakaad bheetiruchyate || 28 || iti savimarsha-sudhaavyaakhyopete brihatpaaraasharahoraashaastre pashthabhaavaphalaadhyaayah || 18 ||

अंग्रेज़ी अर्थ

[If] the lord of the ascendant (lagneshe) is situated in the 6th sign (shashtha-raashisthe -- printed पष्ठराशिस्थे), and (cha) the lord of the 6th (shashthesha api -- printed पष्ठेशोऽपि) is also placed in the 6th (shashthage -- printed पष्ठगे), then in the tenth (dashame) or nineteenth year (ekonavinshe abde), fear from a dog is declared (shunakaat bheetih uchyate). [Colophon:] Thus, in the Brihat Parashara Hora Shastra accompanied by the Sudha commentary-with-discussion, the chapter on the results of the 6th house (shashtha-bhaava-phala-adhyaayah) is concluded. Chapter 18.

हिन्दी अर्थ

यदि लग्नेश (लग्नेशे) षष्ठ राशि में स्थित हो (पष्ठराशिस्थे), और (च) षष्ठेश भी (पष्ठेशोऽपि) षष्ठ में स्थित हो (पष्ठगे), तो दशम (दशमे) अथवा उन्नीसवें वर्ष में (एकोनविंशेऽब्दे) कुत्ते से भय कहा गया है (शुनकाद् भीतिरुच्यते)। [समाप्ति-सूचना:] इस प्रकार सविमर्श सुधा-व्याख्या सहित बृहत्पाराशरहोराशास्त्र में षष्ठ-भाव-फल अध्याय (षष्ठभावफलाध्यायः) समाप्त होता है। अध्याय १८।

स्रोत: BPHS Ch.18, verse 28. PDF p.131, printed page १००. Confirmed via scratchpad/p131-v28.png. DISCLOSURE (प/ष pattern, continuing, three instances in one verse): "षष्ठराशिस्थे", "षष्ठेशोऽपि", and "षष्ठगे" all print with प in place of the first ष ("पष्ठराशिस्थे", "पष्ठेशोऽपि", "पष्ठगे"), matching the recurring substitution already established at refs 18.9, 18.15, 18.21, 18.23. Retained as printed in sanskrit/iast; translation/translationHi use the standard षष्ठ reading. This is the last verse before a substantial Hindi prose commentary block begins immediately below it on the same page (confirmed via scratchpad/p131-v29.png, which shows commentary text, not further verses) -- the commentary itself uses normal ष spellings throughout (e.g. "षष्ठस्थानगत", "षष्ठेश"), consistent with the substitution being confined to the root-verse typesetting rather than the commentary's own type. No chapter-closing colophon has appeared yet; Chapter 18 continues beyond this commentary block. CHAPTER CLOSE: verse 28 is the last verse of Chapter 18; the chapter-closing colophon was confirmed on the following page (PDF p.132, printed page १०१/101) via scratchpad/r-ch18-colophon-133.png, scratchpad/r-ch18-colo-word-133.png and scratchpad/r-ch18-colo-l2-133.png, immediately after the editor's Hindi commentary block marked "॥ १३-२८ ॥" covering verses 13-28. Chapter 18's topic (shashtha-bhaava-phala, the results of the 6th house / disease) matches its colophon title, confirming no misnumbering, and the count of 28 verses is closed. Two typeface notes in the colophon itself, both retained as printed in sanskrit/iast while the standard forms are used in translation/translationHi per established practice: (a) "पष्ठभावफलाध्यायः" prints प in place of the first ष of "षष्ठ", the same recurring-but-inconsistent प/ष substitution established at refs 18.9, 18.15, 18.21, 18.23 and three times within verse 28 itself; (b) unlike the Ch.15, Ch.16 and Ch.17 colophons, this one prints "बृहत्" with a clear ब rather than the व seen there, so the edition's व/ब ambiguity is likewise inconsistent rather than uniform. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

अथ सप्तम (जाया) भावफलाध्यायः ॥ १९ ॥ पराशर उवाच-- अथ मैत्रेय ! ते जाया-भावजं फलमुच्यते । स्वर्क्षे स्वोच्चे तु जायेशे पूर्णंजाया-सुखं वदेत् ॥ १ ॥

atha saptama (jaayaa) bhaavaphalaadhyaayah || 19 || paraashara uvaacha-- atha maitreya ! te jaayaa-bhaavajam phalamuchyate | svarkshe svochche tu jaayeshe poornanjaayaa-sukham vadet || 1 ||

अंग्रेज़ी अर्थ

[Chapter heading:] Now the chapter on the results of the seventh (jaayaa -- the wife) house. Chapter 19. [Parashara said:] Now, O Maitreya, the fruit arising from the house of the wife (jaayaa-bhaava-jam phalam) is declared to you. When the lord of the 7th (jaayeshe) is in its own sign (svarkshe) or in its exaltation (svochche), one should pronounce full happiness from the wife (poornam jaayaa-sukham vadet).

हिन्दी अर्थ

[अध्याय-शीर्षक:] अब सप्तम (जाया) भाव-फल अध्याय। अध्याय १९। [पराशर ने कहा:] हे मैत्रेय! अब तुम्हें जाया-भाव से उत्पन्न फल (जाया-भावजं फलम्) कहा जाता है। जब जायेश (सप्तमेश) अपनी राशि में (स्वर्क्षे) अथवा अपने उच्च में (स्वोच्चे) हो, तो पूर्ण जाया-सुख कहना चाहिये (पूर्णं जाया-सुखं वदेत्)।

स्रोत: BPHS Ch.19, verse 1, opening the chapter. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.132, printed page १०१/101. Confirmed via scratchpad/r19-title-133.png (chapter heading), scratchpad/r19-v1-133.png and scratchpad/r19-v1L2-133.png (verse). The chapter opens immediately below Chapter 18's closing colophon on the same page. "पूर्णंजाया-सुखं" is printed as a single unspaced unit and is transcribed as printed, the sense being "poornam jaayaa-sukham" (full marital happiness). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कलत्रपो विना स्वर्क्षं स्थितः पष्ठेऽष्टमे व्यये । रोगिणीं कुरुते नारीं तथा तुङ्गादिकं विना ॥ २ ॥

kalatrapo vinaa svarksham sthitah pashthe.ashtame vyaye | rogineem kurute naareem tathaa tungaadikam vinaa || 2 ||

अंग्रेज़ी अर्थ

The lord of the 7th (kalatrapa), placed in the 6th, the 8th or the 12th (pashthe ashtame vyaye) without [being in] its own sign (vinaa svarksham), and likewise without exaltation and the like (tathaa tungaadikam vinaa), makes the wife diseased (rogineem kurute naareem).

हिन्दी अर्थ

कलत्रप (सप्तमेश) अपनी राशि के बिना (विना स्वर्क्षं) षष्ठ, अष्टम अथवा व्यय भाव में स्थित हो (पष्ठेऽष्टमे व्यये), तथा उच्च आदि के बिना भी हो (तुङ्गादिकं विना), तो वह स्त्री को रोगिणी बनाता है (रोगिणीं कुरुते नारीं)।

स्रोत: BPHS Ch.19, verse 2. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.132, printed page १०१/101. Confirmed via scratchpad/r19-v2-133.png and scratchpad/r19-v2L2-133.png. DISCLOSURE (प/ष pattern, continuing from Chapter 18): "षष्ठे" prints with प in place of the first ष ("पष्ठे"), the same recurring-but-inconsistent typesetting substitution documented at refs 18.9, 18.15, 18.21, 18.23, 18.28 and in Chapter 18's own colophon; retained as printed in sanskrit/iast while the standard form is used in translation/translationHi per established practice. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सप्तमे तु स्थिते शुक्रेऽतीव कामी भवेन्नरः । यत्र कुत्र स्थिते पापयुते स्त्रीमरणं भवेत् ॥ ३ ॥

saptame tu sthite shukre.ateeva kaamee bhavennarah | yatra kutra sthite paapayute streemaranam bhavet || 3 ||

अंग्रेज़ी अर्थ

But when Venus is placed in the 7th (saptame tu sthite shukre), the man becomes exceedingly lustful (ateeva kaamee bhavet narah). [And when Venus is] placed wherever [it may be] (yatra kutra sthite) joined with a malefic (paapa-yute), the death of the wife occurs (stree-maranam bhavet).

हिन्दी अर्थ

किन्तु शुक्र सप्तम भाव में स्थित हो (सप्तमे तु स्थिते शुक्रे), तो मनुष्य अत्यन्त कामी होता है (अतीव कामी भवेन्नरः)। और [शुक्र] जहाँ कहीं भी स्थित हो (यत्र कुत्र स्थिते) पापग्रह से युक्त हो (पापयुते), तो स्त्री-मरण होता है (स्त्रीमरणं भवेत्)।

स्रोत: BPHS Ch.19, verse 3. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.132, printed page १०१/101. Confirmed via scratchpad/r19-v3-133.png. This verse is followed on the same page by the editor's Hindi prose commentary on verses 1-3, which quotes a half-verse from another classical work; per the standing copyright-safety discipline for this edition, that quotation and the surrounding Hindi commentary are read only as corroborating context and are not transcribed as BPHS content. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

सौम्यैर्युक्तोऽथवा दृष्टः कलत्रेशो बलान्वितः । कुरुते जातकं सर्वं सुख-सम्पत्ति-शालिनम् ॥ ४ ॥

saumyairyukto.athavaa drishtah kalatresho balaanvitah | kurute jaatakam sarvam sukha-sampatti-shaalinam || 4 ||

अंग्रेज़ी अर्थ

The lord of the 7th (kalatresha), joined with or else aspected by benefics (saumyaih yuktah athavaa drishtah) and endowed with strength (balaanvitah), makes the native wholly possessed of happiness and prosperity (kurute jaatakam sarvam sukha-sampatti-shaalinam).

हिन्दी अर्थ

कलत्रेश (सप्तमेश) सौम्य ग्रहों से युक्त अथवा दृष्ट हो (सौम्यैर्युक्तोऽथवा दृष्टः) और बलयुक्त हो (बलान्वितः), तो वह जातक को सर्वथा सुख-सम्पत्ति से युक्त बनाता है (कुरुते जातकं सर्वं सुख-सम्पत्ति-शालिनम्)।

स्रोत: BPHS Ch.19, verse 4. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.132, printed page १०१/101. Confirmed via scratchpad/r19-v4-133.png. Resumes the root verses after the Hindi commentary block on verses 1-3. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जायेशोऽस्तंगते नीच-रिपुभस्थेऽतिदुर्बले । तदीयां सरुजा जाया बहुभार्यः स जायते ॥ ५ ॥

jaayesho.astamgate neecha-ripubhasthe.atidurbale | tadeeyaam sarujaa jaayaa bahubhaaryah sa jaayate || 5 ||

अंग्रेज़ी अर्थ

[When] the lord of the 7th is combust (astam-gate), or placed in a sign of debilitation or of an enemy (neecha-ripu-bha-sthe), [and] exceedingly weak (ati-durbale), his wife is sickly (tadeeyaam sarujaa jaayaa), and he becomes a man of many wives (bahu-bhaaryah sa jaayate).

हिन्दी अर्थ

जायेश (सप्तमेश) अस्तंगत हो (अस्तंगते), अथवा नीच या शत्रु राशि में स्थित हो (नीच-रिपुभस्थे) और अत्यन्त दुर्बल हो (अतिदुर्बले), तो उसकी स्त्री रोगिणी होती है (तदीयां सरुजा जाया) और वह बहु-भार्य होता है (बहुभार्यः स जायते)।

स्रोत: BPHS Ch.19, verse 5. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.132, printed page १०१/101. Confirmed via scratchpad/r19-v5-133.png. DISCLOSURE: the first word prints as "जायेशो" (nominative) where the locative-absolute construction of the rest of the line ("अस्तंगते ... नीच-रिपुभस्थे ... अतिदुर्बले") would call for "जायेशे"; the printed reading is retained as transcribed rather than silently normalised, and the translation renders the construction's evident sense. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कवेः शनेर्वा राशिस्थे सौम्यदृष्टे कलत्रपे । स्वतुङ्गभे तदा जातो बहुदारः प्रजायते ॥ ६ ॥

kaveh shanervaa raashisthe saumyadrishte kalatrape | svatungabhe tadaa jaato bahudaarah prajaayate || 6 ||

अंग्रेज़ी अर्थ

When the lord of the 7th (kalatrapa) is placed in a sign of Venus or of Saturn (kaveh shaneh vaa raashi-sthe) and is aspected by a benefic (saumya-drishte), [or when it is] in its own exaltation portion (sva-tunga-bhe), then the one born becomes a man of many wives (bahu-daarah prajaayate).

हिन्दी अर्थ

कलत्रप (सप्तमेश) शुक्र अथवा शनि की राशि में स्थित हो (कवेः शनेर्वा राशिस्थे) और सौम्य ग्रह से दृष्ट हो (सौम्यदृष्टे), [अथवा] अपने उच्च भाग में हो (स्वतुङ्गभे), तब जातक बहु-दार अर्थात् अनेक स्त्रियों वाला होता है (बहुदारः प्रजायते)।

स्रोत: BPHS Ch.19, verse 6. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v6-134.png. "कवेः" is Venus (kavi, the seer -- Shukra) and "शनेः" Saturn, both in the genitive governing "राशिस्थे". English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वन्ध्यासङ्गो मदे भानौ चन्द्रे राशिसमाः स्त्रियः । कुजे रजस्वलासङ्गो वन्ध्यासङ्गश्च कीर्त्तितः ॥ ७ ॥

vandhyaasango made bhaanau chandre raashisamaah striyah | kuje rajasvalaasango vandhyaasangashcha keerttitah || 7 ||

अंग्रेज़ी अर्थ

With the Sun in the 7th (made bhaanau), union with a barren woman (vandhyaa-sanga); with the Moon [there], the women are as many as the sign indicates (raashi-samaah striyah); with Mars (kuje), union with a woman in her courses (rajasvalaa-sanga), and union with a barren woman too, is declared (keerttitah).

हिन्दी अर्थ

मद (सप्तम) भाव में सूर्य हो (मदे भानौ), तो वन्ध्या स्त्री से सङ्ग (वन्ध्यासङ्गो); चन्द्र हो, तो राशि के तुल्य संख्या में स्त्रियाँ (चन्द्रे राशिसमाः स्त्रियः); मङ्गल हो (कुजे), तो रजस्वला स्त्री से सङ्ग (रजस्वलासङ्गो) तथा वन्ध्या-सङ्ग भी कहा गया है (वन्ध्यासङ्गश्च कीर्त्तितः)।

स्रोत: BPHS Ch.19, verse 7. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v78-134.png, with "रजस्वला" re-checked at 1200dpi (scratchpad/c19-v7-word-134.png) because the ला reads as ल्म at low resolution. DISCLOSURE: the last word prints "कीर्त्तितः" with the doubled त that this press uses after repha; retained as printed, as at ref 3.63, and confirmed by the zoom scratchpad/z-v7-kirtitah.png. "मद" (madа) is this text's name for the 7th house. Rendered literally and clinically, as the root text reads. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

बुधे वेश्या च हीना च वणिक्-स्त्री वा प्रकीर्त्तिता । गुरौ ब्राह्मणभार्या स्याद् गर्भिणी-सङ्ग एव च ॥ ८ ॥

budhe veshyaa cha heenaa cha vanik-stree vaa prakeerttitaa | gurau braahmanabhaaryaa syaad garbhinee-sanga eva cha || 8 ||

अंग्रेज़ी अर्थ

With Mercury [in the 7th] (budhe), a courtesan (veshyaa), or a woman of low station (heenaa), or else a merchant's wife (vanik-stree) is declared. With Jupiter (gurau), the wife is of braahmana [stock] (braahmana-bhaaryaa syaat), and union with a pregnant woman as well (garbhinee-sanga eva cha).

हिन्दी अर्थ

बुध हो (बुधे), तो वेश्या, अथवा हीन कुल की स्त्री, अथवा वणिक्-स्त्री कही गयी है (वेश्या च हीना च वणिक्-स्त्री वा प्रकीर्त्तिता)। गुरु हो (गुरौ), तो ब्राह्मण-भार्या होती है (ब्राह्मणभार्या स्याद्), तथा गर्भिणी-सङ्ग भी (गर्भिणी-सङ्ग एव च)।

स्रोत: BPHS Ch.19, verse 8. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v78-134.png and scratchpad/c19-v8L1-134.png. "वेश्या" prints indistinctly here (the श्य reads as ल्य at low resolution) and was settled against the same word clearly printed at ref 19.12. DISCLOSURE: "प्रकीर्त्तिता" carries the same doubled त as ref 19.7, confirmed at 1200dpi via scratchpad/z-v8-prakirtita.png; retained as printed. Rendered literally and clinically, as the root text reads. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

हीना च पुष्पिणी वाच्या मन्दराहुफणीश्वरैः । कुजेऽस्ते सुस्तनी मन्दे दुर्बला व्याधिसंयुता ॥ ९ ॥

heenaa cha pushpinee vaachyaa mandaraahuphaneeshvaraih | kuje.aste sustanee mande durbalaa vyaadhisamyutaa || 9 ||

अंग्रेज़ी अर्थ

By Saturn, Raahu and Ketu (manda-raahu-phaneeshvaraih) a woman of low station (heenaa) and one in her courses (pushpinee) are to be declared. With Mars in the 7th (kuje aste), she is well formed of breast (sustanee); with Saturn (mande), she is frail and afflicted with disease (durbalaa vyaadhi-samyutaa).

हिन्दी अर्थ

शनि, राहु और केतु के द्वारा (मन्दराहुफणीश्वरैः) हीन कुल की स्त्री तथा पुष्पिणी (रजस्वला) स्त्री कहनी चाहिये (हीना च पुष्पिणी वाच्या)। अस्त (सप्तम) भाव में मङ्गल हो (कुजेऽस्ते), तो स्त्री सुस्तनी होती है; शनि हो (मन्दे), तो वह दुर्बल तथा व्याधि से युक्त होती है (दुर्बला व्याधिसंयुता)।

स्रोत: BPHS Ch.19, verse 9. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v9-134.png and scratchpad/c19-v9b-134.png. "फणीश्वर" (lord of the serpent) is Ketu; "अस्त" (the setting point) is the 7th house. Rendered literally and clinically, as the root text reads. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कठिनोर्ध्वंकुचाऽऽचार्ये सिते स्थूलोत्तमस्तनी । पापे द्वादश-कामस्थे क्षीणचन्द्रस्तु पञ्चमे ॥ १० ॥

kathinordhvamkuchaa..chaarye site sthoolottamastanee | paape dvaadasha-kaamasthe ksheenachandrastu panchame || 10 ||

अंग्रेज़ी अर्थ

With Jupiter (aachaarye) [in the 7th], [the wife is] firm and high of breast (kathina-oordhvam-kuchaa); with Venus (site), full and excellent of breast (sthoola-uttama-stanee). When a malefic is placed in the 12th and in the 7th (paape dvaadasha-kaama-sthe), and the waning Moon is in the 5th (ksheena-chandrah tu panchame) --

हिन्दी अर्थ

आचार्य अर्थात् गुरु हो (आचार्ये), तो [स्त्री] कठिन तथा ऊर्ध्व कुचों वाली होती है (कठिनोर्ध्वंकुचा); शुक्र हो (सिते), तो स्थूल एवं उत्तम स्तनों वाली (स्थूलोत्तमस्तनी)। पापग्रह द्वादश तथा काम (सप्तम) भाव में स्थित हो (पापे द्वादश-कामस्थे), और क्षीण चन्द्र पञ्चम में हो (क्षीणचन्द्रस्तु पञ्चमे) --

स्रोत: BPHS Ch.19, verse 10. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v10-134.png. The second half is a protasis whose result is given at ref 19.11. DISCLOSURE: the edition prints a double avagraha in "कुचाऽऽचार्ये" (marking the aa+aa elision of kuchaa + aachaarye); it is rendered ".." in the iast field, following this file's convention of writing a single avagraha as ".". "काम" here names the 7th house. Rendered literally and clinically, as the root text reads. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जातश्च भार्यावश्यः स्या-दिति जातिविरोधकृत् । जामित्रे मन्दभौमे तु तदीशे मन्दभूमिजे ॥ ११ ॥

jaatashcha bhaaryaavashyah syaa-diti jaativirodhakrit | jaamitre mandabhaume tu tadeeshe mandabhoomije || 11 ||

अंग्रेज़ी अर्थ

-- and the one born becomes subject to his wife (bhaaryaa-vashyah), and thus one who acts against [the custom of] his caste (jaati-virodha-krit). But when Saturn and Mars are in the 7th (jaamitre manda-bhaume), or when its lord is Saturn or Mars (tad-eeshe manda-bhoomije) --

हिन्दी अर्थ

-- और जातक भार्या के वश में रहने वाला होता है (जातश्च भार्यावश्यः स्याद्), इस प्रकार जाति-विरोध करने वाला (इति जातिविरोधकृत्)। किन्तु जामित्र (सप्तम) में शनि और मङ्गल हों (जामित्रे मन्दभौमे), अथवा उसका स्वामी शनि या मङ्गल हो (तदीशे मन्दभूमिजे) --

स्रोत: BPHS Ch.19, verse 11. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v11-134.png. The first half completes the protasis begun at ref 19.10; the second half opens the protasis completed at ref 19.12. "जामित्र" is this text's name for the 7th house. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

वेश्या वा जारिणी वापि तस्य भार्या न संशयः । भौमांशकगते शुक्रे भौमक्षेत्र-गतेऽथवा ॥ १२ ॥

veshyaa vaa jaarinee vaapi tasya bhaaryaa na samshayah | bhaumaamshakagate shukre bhaumakshetra-gate.athavaa || 12 ||

अंग्रेज़ी अर्थ

-- his wife is a courtesan (veshyaa) or else an unfaithful woman (jaarinee), there is no doubt of it. When Venus is placed in a navaamsha of Mars (bhauma-amshaka-gate shukre), or else placed in a sign of Mars (bhauma-kshetra-gate athavaa) --

हिन्दी अर्थ

-- उसकी भार्या वेश्या अथवा जारिणी होती है, इसमें संशय नहीं (तस्य भार्या न संशयः)। शुक्र भौम के अंशक में स्थित हो (भौमांशकगते शुक्रे), अथवा भौम के क्षेत्र में स्थित हो (भौमक्षेत्र-गतेऽथवा) --

स्रोत: BPHS Ch.19, verse 12. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v12-134.png, which also carries the clearest printing of "वेश्या" on the page and settles the same word at ref 19.8. Rendered literally and clinically, as the root text reads. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

भौमयुक्तेऽथवा दृष्टे भगचुम्बनभाग् भवेत् । मन्दांशकगते शुक्रे मन्द-क्षेत्र-गतेऽपि च ॥ १३ ॥

bhaumayukte.athavaa drishte bhagachumbanabhaag bhavet | mandaamshakagate shukre manda-kshetra-gate.api cha || 13 ||

अंग्रेज़ी अर्थ

-- or joined with Mars, or else aspected [by it], he becomes one given to oral contact with the female organ (bhaga-chumbana-bhaak). When Venus is placed in a navaamsha of Saturn (manda-amshaka-gate shukre), and likewise placed in a sign of Saturn (manda-kshetra-gate api cha) --

हिन्दी अर्थ

-- अथवा भौम से युक्त हो या दृष्ट हो (भौमयुक्तेऽथवा दृष्टे), तो जातक भगचुम्बन का भागी होता है (भगचुम्बनभाग् भवेत्)। शुक्र मन्द (शनि) के अंशक में स्थित हो (मन्दांशकगते शुक्रे), तथा मन्द के क्षेत्र में भी स्थित हो (मन्द-क्षेत्र-गतेऽपि च) --

स्रोत: BPHS Ch.19, verse 13. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v13-134.png. The first half completes the protasis begun at ref 19.12; the second half opens the one completed at ref 19.14. Rendered literally and clinically, as the root text reads. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

मन्दयुक्ते च दृष्टे च शिश्न-चुम्बनसत्परः । दारेशे स्वोच्च-राशिस्थे घने शुभसमन्विते ॥ १४ ॥

mandayukte cha drishte cha shishna-chumbanasatparah | daareshe svochcha-raashisthe ghane shubhasamanvite || 14 ||

अंग्रेज़ी अर्थ

-- and joined with Saturn and aspected [by it], he is given to oral contact with the male organ (shishna-chumbana-tatparah). When the lord of the wife (daaresha, the 7th lord) is placed in its own exaltation sign, firm [in strength] (ghane) and joined with benefics (shubha-samanvite) --

हिन्दी अर्थ

-- और मन्द (शनि) से युक्त तथा दृष्ट हो (मन्दयुक्ते च दृष्टे च), तो जातक शिश्न-चुम्बन में तत्पर होता है (शिश्न-चुम्बनसत्परः)। दारेश (सप्तमेश) अपनी उच्च राशि में स्थित हो (दारेशे स्वोच्च-राशिस्थे), घन अर्थात् दृढ़ बल वाला हो (घने) और शुभ ग्रहों से समन्वित हो (शुभसमन्विते) --

स्रोत: BPHS Ch.19, verse 14. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v14-134.png. TWO PRINTED READINGS RETAINED AS PRINTED, both settled at 1200dpi rather than corrected silently: (1) the edition prints "सत्परः" where the idiom is "तत्परः" (the स is unambiguous in scratchpad/z-v14-satparah2.png); the translation renders the evident sense "tatparah", devoted to. (2) the word before "शुभसमन्विते" prints with a closed bottom-left loop, i.e. "घने" and not "धने" (scratchpad/z-v14-ghane.png); "ghana" in the sense firm/compact/strong reads coherently with "दारेशे", so no emendation is made -- but a reader should know that "धने" (the 2nd house joined with benefics) is the alternative that the surrounding grammar would equally allow. The घ reading is now settled against a control from the same fount: ref 19.28 prints "धनेशे" with the open-hooked ध, and set beside it (scratchpad/z-dha-vs-gha.png) this verse's letter is plainly the closed-loop घ. The second half is a protasis whose result is given at ref 19.15. Rendered literally and clinically, as the root text reads. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

लग्नेशे बलसंयुक्ते कलत्रस्थानगे सति । पुत्रपौत्रादि-संयुक्ता गुणाढ्या तस्य गेहिनी ॥ १५ ॥

lagneshe balasamyukte kalatrasthaanage sati | putrapautraadi-samyuktaa gunaadhyaa tasya gehinee || 15 ||

अंग्रेज़ी अर्थ

When the lord of the lagna, endowed with strength (bala-samyukte), is placed in the house of the wife (kalatra-sthaana-ge sati), his housewife (gehinee) is blessed with sons and grandsons and the rest (putra-pautra-aadi-samyuktaa), and rich in virtues (gunaadhyaa).

हिन्दी अर्थ

लग्नेश बल से युक्त हो (लग्नेशे बलसंयुक्ते) और कलत्र-स्थान (सप्तम भाव) में स्थित हो (कलत्रस्थानगे सति), तो उसकी गृहिणी पुत्र-पौत्र आदि से युक्त (पुत्रपौत्रादि-संयुक्ता) तथा गुणों से समृद्ध होती है (गुणाढ्या तस्य गेहिनी)।

स्रोत: BPHS Ch.19, verse 15. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v15-134.png, with the second line re-read at higher magnification (scratchpad/z-v15-l2a.png, scratchpad/z-v15-l2b.png) because the u-matras of "पुत्र" and "संयुक्ता" fall at the very foot of the line. This verse's result also serves as the apodosis of the protasis left open at ref 19.14. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

जायेशे रिपुनीचस्थे मूढे वा पापवीक्षिते । पापेक्षितयुते वाऽस्ते जायाहानिं विनिर्दिशेत् ॥ १६ ॥

jaayeshe ripuneechasthe moodhe vaa paapaveekshite | paapekshitayute vaa.aste jaayaahaanim vinirdishet || 16 ||

अंग्रेज़ी अर्थ

When the lord of the 7th (jaayesha) is placed in an enemy's sign or in debilitation (ripu-neecha-sthe), or is combust (moodhe), or is aspected by malefics (paapa-veekshite); or when the 7th house itself (aste) is aspected by and joined with malefics (paapa-ekshita-yute), one should declare the loss of the wife (jaayaa-haanim vinirdishet).

हिन्दी अर्थ

जायेश (सप्तमेश) शत्रु अथवा नीच राशि में स्थित हो (रिपुनीचस्थे), अथवा मूढ (अस्तंगत) हो (मूढे), अथवा पापग्रहों से दृष्ट हो (पापवीक्षिते); अथवा अस्त (सप्तम) भाव पापग्रहों से दृष्ट एवं युक्त हो (पापेक्षितयुते वाऽस्ते), तो जाया-हानि कहनी चाहिये (जायाहानिं विनिर्दिशेत्)।

स्रोत: BPHS Ch.19, verse 16. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v16-134.png, second line re-read at scratchpad/z-v16-l2a.png and scratchpad/z-v16-l2b.png. "मूढ" (bewildered, obscured) is the text's word for a combust planet. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

षष्ठेऽष्टमे व्यये वापि मदेशो दुर्बलो यदि । नीचराशिगतः किंवा दारनाशं विनिर्दिशेत् ॥ १७ ॥

shashthe.ashtame vyaye vaapi madesho durbalo yadi | neecharaashigatah kimvaa daaranaasham vinirdishet || 17 ||

अंग्रेज़ी अर्थ

If the lord of the 7th (madesha) is weak (durbalo) in the 6th, the 8th or else the 12th, or if it is placed in its sign of debilitation (neecha-raashi-gatah kim vaa), one should declare the destruction of the wife (daara-naasham vinirdishet).

हिन्दी अर्थ

यदि मदेश (सप्तमेश) षष्ठ, अष्टम अथवा व्यय भाव में दुर्बल हो (षष्ठेऽष्टमे व्यये वापि मदेशो दुर्बलो यदि), अथवा नीच राशि में स्थित हो (नीचराशिगतः किंवा), तो दार-नाश कहना चाहिये (दारनाशं विनिर्दिशेत्)।

स्रोत: BPHS Ch.19, verse 17. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.133, printed page १०२/102. Confirmed via scratchpad/c19-v17-134.png, second line re-read at scratchpad/z-v17-l2a.png and scratchpad/z-v17-l2b.png. NOTE ON THE प/ष PATTERN: here "षष्ठे" prints correctly with ष, where ref 19.2 and several Chapter 18 refs print प for the first ष. That confirms the substitution is inconsistent typesetting in this edition rather than a systematic orthography, which is why each occurrence is transcribed exactly as it stands on its own page. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कलत्र-स्थानगे चन्द्रे तदीशे व्ययराशिगे । कारको बलहीनश्च दारसौख्यं न विद्यते ॥ १८ ॥

kalatra-sthaanage chandre tadeeshe vyayaraashige | kaarako balaheenashcha daarasaukhyam na vidyate || 18 ||

अंग्रेज़ी अर्थ

When the Moon is placed in the house of the wife (kalatra-sthaana-ge chandre), its lord is placed in the sign of the 12th (tad-eeshe vyaya-raashi-ge), and the significator [of the wife] is devoid of strength (kaarako balaheenah cha), happiness from the wife is not to be found (daara-saukhyam na vidyate).

हिन्दी अर्थ

चन्द्रमा कलत्र-स्थान (सप्तम भाव) में स्थित हो (कलत्र-स्थानगे चन्द्रे), उसका स्वामी व्यय-राशि में हो (तदीशे व्ययराशिगे), और [स्त्री-] कारक ग्रह बलहीन हो (कारको बलहीनश्च), तो दार-सौख्य नहीं होता (दारसौख्यं न विद्यते)।

स्रोत: BPHS Ch.19, verse 18. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.134, printed page १०३/103. Confirmed via scratchpad/q18-135.png (600dpi). The edition's own Hindi prose gloss that follows -- which closes with the range mark "॥ ७-१८ ॥", showing it summarises verses 7 to 18 together -- reads this verse the same way; that gloss is the modern editor's and is used here only as corroborating context, not transcribed. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

नीचे पापर्क्षगे वापि सपापे च कलत्रपे । क्लीबग्रहे सप्तमस्थे द्विभार्यो जायते नरः ॥ १९ ॥

neeche paaparkshage vaapi sapaape cha kalatrape | kleebagrahe saptamasthe dvibhaaryo jaayate narah || 19 ||

अंग्रेज़ी अर्थ

When the lord of the 7th (kalatrapa) is in debilitation (neeche), or else placed in a malefic's sign (paapa-riksha-ge), and is together with a malefic (sa-paape); and a neuter planet (kleeba-graha) is placed in the 7th, the man is born having two wives (dvi-bhaaryo jaayate narah).

हिन्दी अर्थ

कलत्रप (सप्तमेश) नीच राशि में हो (नीचे), अथवा पाप-ऋक्ष में स्थित हो (पापर्क्षगे वापि), और पापग्रह के साथ हो (सपापे च); तथा क्लीब ग्रह सप्तम भाव में स्थित हो (क्लीबग्रहे सप्तमस्थे), तो मनुष्य द्विभार्य होता है (द्विभार्यो जायते नरः)।

स्रोत: BPHS Ch.19, verse 19. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.134, printed page १०३/103. Confirmed via scratchpad/q19-21-135.png (600dpi). This verse stands under the editor's own printed subheading "द्विभार्यादिपत्नीयोग--" (the yogas for two wives and so on); that subheading is the modern editor's and is named here rather than transcribed as root text. The editor's Hindi gloss below identifies the "क्लीबग्रह" (neuter planets) of this verse as Mercury and Saturn -- again corroborating context only. English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

कलत्रस्थानगे भौमे शुक्रे जामित्रगे शनौ । लग्नेशे रन्ध्रराशिस्थे कलत्रत्रयवान् भवेत् ॥ २० ॥

kalatrasthaanage bhaume shukre jaamitrage shanau | lagneshe randhraraashisthe kalatratrayavaan bhavet || 20 ||

अंग्रेज़ी अर्थ

When Mars is placed in the house of the wife (kalatra-sthaana-ge bhaume), and Venus and Saturn are in the 7th (shukre jaamitra-ge shanau), and the lord of the lagna is placed in the sign of the 8th (lagneshe randhra-raashi-sthe), he becomes possessed of three wives (kalatra-traya-vaan bhavet).

हिन्दी अर्थ

भौम कलत्र-स्थान में स्थित हो (कलत्रस्थानगे भौमे), शुक्र तथा शनि जामित्र (सप्तम) में हों (शुक्रे जामित्रगे शनौ), और लग्नेश रन्ध्र (अष्टम) राशि में स्थित हो (लग्नेशे रन्ध्रराशिस्थे), तो जातक कलत्र-त्रयवान् अर्थात् तीन स्त्रियों वाला होता है (कलत्रत्रयवान् भवेत्)।

स्रोत: BPHS Ch.19, verse 20. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.134, printed page १०३/103. Confirmed via scratchpad/q19-21-135.png (600dpi). "कलत्रस्थान", "जामित्र" and "रन्ध्र" are this text's names for the 7th, the 7th and the 8th respectively; the verse uses two different names for the 7th in a single line. The editor's Hindi gloss below reads the line the same way (all three of Mars, Venus and Saturn in the 7th). English/Hindi meanings by Vedic Hora -- for review.

संस्कृत

द्विस्वभावगते शुक्रे स्वोच्चे तद्राशिनायके । दारेशे बलसंयुक्ते बहुदार-समन्वितः ॥ २१ ॥

dvisvabhaavagate shukre svochche tadraashinaayake | daareshe balasamyukte bahudaara-samanvitah || 21 ||

अंग्रेज़ी अर्थ

When Venus is placed in a dual sign (dvi-svabhaava-gate shukre), the lord of that sign is in its own exaltation (svochche tad-raashi-naayake), and the lord of the 7th is endowed with strength (daaresha bala-samyukte), [the native] is possessed of many wives (bahu-daara-samanvitah).

हिन्दी अर्थ

शुक्र द्विस्वभाव राशि में स्थित हो (द्विस्वभावगते शुक्रे), उस राशि का स्वामी अपने उच्च में हो (स्वोच्चे तद्राशिनायके), और दारेश (सप्तमेश) बल से युक्त हो (दारेशे बलसंयुक्ते), तो जातक बहु-दार से समन्वित अर्थात् अनेक स्त्रियों वाला होता है (बहुदार-समन्वितः)।

स्रोत: BPHS Ch.19, verse 21. Kashi Sanskrit Series No.220 (ed. Devchandra Jha, Chaukhamba Sanskrit Sansthan, Varanasi, VS 2036). PDF p.134, printed page १०३/103. Confirmed via scratchpad/q19-21-135.png (600dpi). The editor's Hindi gloss on this verse runs over onto the following page and is not transcribed. English/Hindi meanings by Vedic Hora -- for review.